Potri.001G350600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G14920 103 / 3e-26 Gibberellin-regulated family protein (.1.2)
AT1G75750 71 / 9e-16 GASA1 GAST1 protein homolog 1 (.1.2)
AT2G18420 65 / 1e-13 Gibberellin-regulated family protein (.1)
AT1G22690 65 / 3e-13 Gibberellin-regulated family protein (.1.2.3)
AT4G09600 64 / 5e-13 GASA3 GAST1 protein homolog 3 (.1)
AT5G15230 57 / 1e-10 GASA4 GAST1 protein homolog 4 (.1.2)
AT2G14900 55 / 1e-09 Gibberellin-regulated family protein (.1)
AT1G74670 54 / 2e-09 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
AT2G39540 52 / 5e-09 Gibberellin-regulated family protein (.1)
AT5G59845 51 / 1e-08 Gibberellin-regulated family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G076700 95 / 8e-25 AT2G18420 85 / 9e-23 Gibberellin-regulated family protein (.1)
Potri.015G071500 95 / 8e-25 AT5G14920 90 / 5e-23 Gibberellin-regulated family protein (.1.2)
Potri.019G083900 77 / 4e-18 AT1G22690 103 / 1e-29 Gibberellin-regulated family protein (.1.2.3)
Potri.005G239000 72 / 4e-16 AT2G18420 117 / 6e-36 Gibberellin-regulated family protein (.1)
Potri.005G239100 72 / 5e-16 AT1G75750 112 / 1e-33 GAST1 protein homolog 1 (.1.2)
Potri.002G022600 70 / 2e-15 AT1G75750 110 / 4e-33 GAST1 protein homolog 1 (.1.2)
Potri.002G022700 67 / 3e-14 AT1G75750 94 / 1e-26 GAST1 protein homolog 1 (.1.2)
Potri.002G022500 67 / 4e-14 AT2G18420 99 / 2e-28 Gibberellin-regulated family protein (.1)
Potri.013G113400 66 / 4e-14 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039443 110 / 4e-30 AT5G14920 103 / 2e-27 Gibberellin-regulated family protein (.1.2)
Lus10034524 73 / 2e-16 AT1G75750 94 / 3e-26 GAST1 protein homolog 1 (.1.2)
Lus10033145 71 / 1e-15 AT1G75750 81 / 2e-21 GAST1 protein homolog 1 (.1.2)
Lus10017212 69 / 4e-15 AT1G75750 107 / 3e-32 GAST1 protein homolog 1 (.1.2)
Lus10014262 67 / 7e-14 AT4G09600 86 / 7e-23 GAST1 protein homolog 3 (.1)
Lus10009421 68 / 1e-13 AT1G22690 90 / 1e-23 Gibberellin-regulated family protein (.1.2.3)
Lus10025962 65 / 3e-13 AT4G09600 87 / 1e-23 GAST1 protein homolog 3 (.1)
Lus10004048 63 / 8e-13 AT1G74670 109 / 1e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
Lus10024791 58 / 4e-11 AT5G59845 114 / 5e-35 Gibberellin-regulated family protein (.1)
Lus10018708 58 / 5e-11 AT5G59845 114 / 8e-35 Gibberellin-regulated family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02704 GASA Gibberellin regulated protein
Representative CDS sequence
>Potri.001G350600.3 pacid=42788943 polypeptide=Potri.001G350600.3.p locus=Potri.001G350600 ID=Potri.001G350600.3.v4.1 annot-version=v4.1
ATGGCTTTCAAAGCTGTTTGTCTTATGGTGGTTGCTTTTGTTTTAGTTACTGCAAAGGCTTCATACATGAATGAAGACTTCAAGGAGAAGGCTGTTTTTT
CCAAATCTGTGGTGCCTGCATCAACTCCTGCTCCTCCAGAGGTCAAGTCACCGACCCCCGCCCCACCAGTGGTCACTCCTTCCACACCATTGTACAAACC
ACCAACTCCCGCGCCACCAGTTAAGACACCACCTCCAGCACCGCCAGTCAACCCCCCCACACCTGTGAAGCCACCCACTACTCCCGCCCCACCGGTCTAC
AAGCCACCATCTCCAGCACCGCCAGTCAACCCCCCCACACCTGTGAAGCCACCCACTACTCCCGCCCCACCGGTCTACAAGCCACCATCTCCAGCACCGC
CAGTCAACCCCCCCACACCTGTGCCTCCTGTGAAGCCACCCACTGCTCCTGCCCCACCGGTCTACAAGCCACCATCTCCAGCACCCACACCTGTGCCTCC
CGTGAAGCCACCCACTACTGGACCAATGCCCCCGCCAGTTAGGACAAGATCGGATTGCACCCCTCTATGTGGGCAGAGGTGTAAGTTACATTCAAGAAAA
AGACTCTGTGTTAGAGCTTGCATGACTTGCTGTGACAGATGCAAATGCGTGCCGCCGGGGACTTACGGTAACAGGGAGAAATGTGGCAAGTGCTATACTG
ACATGACCACCCGCCGCAACAAGCCCAAGTGCCCTTGA
AA sequence
>Potri.001G350600.3 pacid=42788943 polypeptide=Potri.001G350600.3.p locus=Potri.001G350600 ID=Potri.001G350600.3.v4.1 annot-version=v4.1
MAFKAVCLMVVAFVLVTAKASYMNEDFKEKAVFSKSVVPASTPAPPEVKSPTPAPPVVTPSTPLYKPPTPAPPVKTPPPAPPVNPPTPVKPPTTPAPPVY
KPPSPAPPVNPPTPVKPPTTPAPPVYKPPSPAPPVNPPTPVPPVKPPTAPAPPVYKPPSPAPTPVPPVKPPTTGPMPPPVRTRSDCTPLCGQRCKLHSRK
RLCVRACMTCCDRCKCVPPGTYGNREKCGKCYTDMTTRRNKPKCP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G14920 Gibberellin-regulated family p... Potri.001G350600 0 1
AT5G15150 HD ATHB3, HAT7, AT... HOMEOBOX FROM ARABIDOPSIS THAL... Potri.017G081700 1.41 0.9518
AT4G16740 ATTPS03 terpene synthase 03 (.1.2) Potri.007G119700 2.44 0.9066
AT1G01110 IQD18 IQ-domain 18 (.1.2) Potri.012G022500 3.16 0.9424
AT4G15140 unknown protein Potri.011G108700 3.87 0.8961
AT3G62630 Protein of unknown function (D... Potri.005G019600 4.47 0.9070
AT3G05600 alpha/beta-Hydrolases superfam... Potri.013G013500 8.12 0.9001
AT1G07300 josephin protein-related (.1) Potri.001G249500 10.48 0.8875
AT2G22840 GRF ATGRF1 growth-regulating factor 1 (.1... Potri.014G007200 11.48 0.8255
AT5G45670 GDSL-like Lipase/Acylhydrolase... Potri.011G076400 16.00 0.9089
AT3G50390 Transducin/WD40 repeat-like su... Potri.006G239600 16.34 0.9096

Potri.001G350600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.