Potri.001G352900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G60970 278 / 4e-97 SNARE-like superfamily protein (.1)
AT3G09800 270 / 9e-94 SNARE-like superfamily protein (.1)
AT4G08520 268 / 7e-93 SNARE-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G043200 259 / 2e-89 AT1G60970 288 / 4e-101 SNARE-like superfamily protein (.1)
Potri.001G197200 257 / 8e-89 AT3G09800 287 / 1e-100 SNARE-like superfamily protein (.1)
Potri.007G025400 44 / 9e-06 AT3G50860 296 / 1e-104 Clathrin adaptor complex small chain family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037624 258 / 8e-89 AT4G08520 287 / 3e-100 SNARE-like superfamily protein (.1)
Lus10006883 258 / 8e-89 AT4G08520 287 / 3e-100 SNARE-like superfamily protein (.1)
Lus10025383 244 / 3e-83 AT1G60970 235 / 6e-80 SNARE-like superfamily protein (.1)
Lus10015263 44 / 1e-06 AT1G60970 55 / 4e-11 SNARE-like superfamily protein (.1)
Lus10012924 41 / 9e-05 AT2G19790 280 / 6e-99 SNARE-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0431 PF PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Representative CDS sequence
>Potri.001G352900.2 pacid=42789694 polypeptide=Potri.001G352900.2.p locus=Potri.001G352900 ID=Potri.001G352900.2.v4.1 annot-version=v4.1
ATGGAGCTGTGCCCTTGCGTAAAAAATATCCTTCTACTGGATTTTGAAGGGAAGCGTGTGGCTTCCAAGTATTTTTGTGATGACTGGCCAACTAATGGTG
CCAAAGAAGCTTTTGAGAAAGCTGTGTTTAACAAGACTCAAAAGACTAATGCACGCTCGGAAGTTGAGGTAACAATGCTTGAGAACAACATTGTTGTTTA
CAAGTTTGTTCAAGATCTACACTTTTTTGTTACTGGAGGTGAAGAAGAAAATGAGGTCATCTTAGCCACAGTCCTTCAAGGGTTCTTTGATGCAGTTGGC
CTTCTCCTTAGAGGCAATGTAGAGAAAAGAGAGGCACTTGAGTATCTAGATCTCATCCTGCTGTGCATTGATGAAATTGTTGATGGCGGTATTATTTTGG
AAACCGATGCAAATGTCATTGTGGGGAAGGTTGCAAGTCATAGTACAGTTGCTGAAGGATTGTCTGAGCAGACATTCTCACAAGCACTGGCAACTGCACG
GGAACATCTAGCAAGGTCCCTTCTTAAGTGA
AA sequence
>Potri.001G352900.2 pacid=42789694 polypeptide=Potri.001G352900.2.p locus=Potri.001G352900 ID=Potri.001G352900.2.v4.1 annot-version=v4.1
MELCPCVKNILLLDFEGKRVASKYFCDDWPTNGAKEAFEKAVFNKTQKTNARSEVEVTMLENNIVVYKFVQDLHFFVTGGEEENEVILATVLQGFFDAVG
LLLRGNVEKREALEYLDLILLCIDEIVDGGIILETDANVIVGKVASHSTVAEGLSEQTFSQALATAREHLARSLLK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G60970 SNARE-like superfamily protein... Potri.001G352900 0 1
AT4G20410 GAMMA-SNAP, GSN... gamma-soluble NSF attachment p... Potri.011G155200 1.00 0.8992 Pt-GSNAP.1
AT3G23325 Splicing factor 3B subunit 5/R... Potri.010G070500 2.44 0.8555
AT5G17060 ATARFB1B ADP-ribosylation factor B1B (.... Potri.013G088800 10.48 0.8065
AT5G60460 Preprotein translocase Sec, Se... Potri.009G012000 13.67 0.8296
AT1G09630 ATRAB-A2A, ATRA... ARABIDOPSIS RAB GTPASE A2A, RA... Potri.003G004100 15.09 0.8287
AT5G59890 ADF4, ATADF4 actin depolymerizing factor 4 ... Potri.009G028200 16.85 0.8500 Pt-ADF1.1
AT3G13410 unknown protein Potri.001G000900 18.05 0.8672
AT1G05720 selenoprotein family protein (... Potri.013G126900 21.54 0.8207
AT3G51040 RTH RTE1-homolog (.1.2.3) Potri.007G017900 26.72 0.8418
AT5G42000 ORMDL family protein (.1.2) Potri.001G086300 28.24 0.8415

Potri.001G352900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.