Potri.001G354500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G29520 194 / 3e-64 AWPM-19-like family protein (.1)
AT5G46530 189 / 2e-62 AWPM-19-like family protein (.1)
AT5G18970 98 / 3e-26 AWPM-19-like family protein (.1)
AT1G04560 83 / 3e-20 AWPM-19-like family protein (.1)
AT4G39925 43 / 2e-06 AT hook motif DNA-binding family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G077800 213 / 1e-71 AT5G46530 164 / 2e-52 AWPM-19-like family protein (.1)
Potri.010G064200 86 / 3e-21 AT1G04560 214 / 2e-71 AWPM-19-like family protein (.1)
Potri.008G200000 79 / 8e-19 AT5G18970 216 / 1e-72 AWPM-19-like family protein (.1)
Potri.008G200300 69 / 3e-15 AT5G18970 186 / 4e-61 AWPM-19-like family protein (.1)
Potri.017G113000 67 / 2e-14 AT1G04560 155 / 2e-48 AWPM-19-like family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025374 218 / 7e-74 AT5G46530 241 / 4e-83 AWPM-19-like family protein (.1)
Lus10015255 214 / 2e-72 AT5G46530 240 / 2e-82 AWPM-19-like family protein (.1)
Lus10004587 212 / 3e-71 AT5G46530 240 / 2e-82 AWPM-19-like family protein (.1)
Lus10011973 211 / 6e-71 AT5G46530 240 / 2e-82 AWPM-19-like family protein (.1)
Lus10023713 83 / 2e-20 AT1G04560 254 / 2e-87 AWPM-19-like family protein (.1)
Lus10014456 81 / 1e-19 AT1G04560 254 / 2e-87 AWPM-19-like family protein (.1)
Lus10001116 76 / 8e-18 AT5G18970 216 / 1e-72 AWPM-19-like family protein (.1)
Lus10021949 66 / 5e-14 AT5G18970 226 / 1e-76 AWPM-19-like family protein (.1)
Lus10041238 66 / 6e-14 AT5G18970 225 / 2e-76 AWPM-19-like family protein (.1)
Lus10033541 43 / 2e-05 AT1G04560 91 / 2e-23 AWPM-19-like family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05512 AWPM-19 AWPM-19-like family
Representative CDS sequence
>Potri.001G354500.1 pacid=42793342 polypeptide=Potri.001G354500.1.p locus=Potri.001G354500 ID=Potri.001G354500.1.v4.1 annot-version=v4.1
ATGGTACTCTCGCAGCAGATAAAACTTGTTGCCTTGCTACTTCTGGTCTTAAATTTCTGCATGTATGTCATTGTTTTGGGGATTGGCGGTTGGGCTATGA
ATAGAGCCATTGATCATGGTTTCATCATTGGACCTGGGTTTGACCTGCCAGCACATTTCTCACCTATTTACTTCCCTATGGGAAATGCTGCCACTGGATT
CTTCGTGATGTTTGCTTTGATCGCCGGAGTTGTTGGTGTTGCCTCAGCAATTGTTGGTCTTAATCACATTCGGACTTGGACCGGCGACAGCTTGCCATCT
GCAGCCTCCGTTGCTGCCGTTTCTTGGACTCTCACTCTTCTAGCCATGGGCTTCGCCTGGAAAGAAATTGAGCTCTCTATCAGGAACGCCCGTCTGAGAA
CCATGGAGGCATTTCTGATAATCCTTTCTGCTACACAGCTTCTATACATAGCAGCCATCCACGGTGCCTCGTCATTTAGGAGACCTTAA
AA sequence
>Potri.001G354500.1 pacid=42793342 polypeptide=Potri.001G354500.1.p locus=Potri.001G354500 ID=Potri.001G354500.1.v4.1 annot-version=v4.1
MVLSQQIKLVALLLLVLNFCMYVIVLGIGGWAMNRAIDHGFIIGPGFDLPAHFSPIYFPMGNAATGFFVMFALIAGVVGVASAIVGLNHIRTWTGDSLPS
AASVAAVSWTLTLLAMGFAWKEIELSIRNARLRTMEAFLIILSATQLLYIAAIHGASSFRRP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G29520 AWPM-19-like family protein (.... Potri.001G354500 0 1
AT1G53708 RTFL9 ROTUNDIFOLIA like 9 (.1) Potri.001G161200 2.44 0.9200
AT4G01410 Late embryogenesis abundant (L... Potri.014G106100 4.47 0.9081
AT1G53708 RTFL9 ROTUNDIFOLIA like 9 (.1) Potri.003G073900 5.47 0.9187
AT3G02720 Class I glutamine amidotransfe... Potri.004G076000 6.70 0.9115
AT1G49320 ATUSPL1 unknown seed protein like 1 (.... Potri.009G114600 7.34 0.9114
AT5G24800 bZIP BZO2H2, ATBZIP9 BASIC LEUCINE ZIPPER O2 HOMOLO... Potri.006G277800 8.66 0.9020
AT1G14040 EXS (ERD1/XPR1/SYG1) family pr... Potri.010G165300 8.66 0.9139
AT3G02720 Class I glutamine amidotransfe... Potri.004G076200 9.79 0.9015
AT3G02720 Class I glutamine amidotransfe... Potri.004G075900 10.81 0.9036
AT5G16770 MYB ATMYB9 myb domain protein 9 (.1.2) Potri.019G050900 12.48 0.9135 MYB101.1

Potri.001G354500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.