Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G43850 49 / 2e-08 SEU SEUSS transcriptional co-regulator (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G089900 [exp] 102 / 2e-29 AT1G43850 172 / 6e-50 SEUSS transcriptional co-regulator (.1.2) Potri.010G052150 [exp] 87 / 9e-24 AT1G43850 49 / 9e-08 SEUSS transcriptional co-regulator (.1.2) Potri.005G186900 [exp] 91 / 2e-23 AT1G43850 612 / 0.0 SEUSS transcriptional co-regulator (.1.2) Potri.002G072900 [exp] 85 / 5e-21 AT1G43850 569 / 0.0 SEUSS transcriptional co-regulator (.1.2) Potri.007G109400 [exp] 52 / 2e-09 AT1G43850 546 / 0.0 SEUSS transcriptional co-regulator (.1.2) Potri.005G058501 [exp] 45 / 3e-07 AT1G43850 158 / 2e-41 SEUSS transcriptional co-regulator (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042785 [exp] 48 / 7e-08 AT1G43850 721 / 0.0 SEUSS transcriptional co-regulator (.1.2) Lus10029756 [exp] 47 / 1e-07 AT1G43850 721 / 0.0 SEUSS transcriptional co-regulator (.1.2) Lus10028635 [exp] 42 / 5e-06 AT1G43850 518 / 5e-174 SEUSS transcriptional co-regulator (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G355900.1 pacid=42788211 polypeptide=Potri.001G355900.1.p locus=Potri.001G355900 ID=Potri.001G355900.1.v4.1 annot-version=v4.1 ATGCAAATCACTGCTAGCAATGGTATGGCTAGTGTAAATAACTCACTCACCACAACATCTACAACCATGTCTGCTAGCACTATTGTGGGGCTTCTCTACC AAAATTCAATGAATTCAAGACACCAAAATTCTATGAATAATGCAAGCAGTCCCTATGGAGGAAACTCTGTTCAGATTCAATCTCCTGGTTACTCCACCTT GACCACTATATCCTGA
AA sequence Show only first row Show all	>Potri.001G355900.1 pacid=42788211 polypeptide=Potri.001G355900.1.p locus=Potri.001G355900 ID=Potri.001G355900.1.v4.1 annot-version=v4.1 MQITASNGMASVNNSLTTTSTTMSASTIVGLLYQNSMNSRHQNSMNNASSPYGGNSVQIQSPGYSTLTTIS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G43850		SEU	SEUSS transcriptional co-regul...		Potri.001G355900 [exp]	0	1
AT1G23230			unknown protein		Potri.010G108350 [exp]	3.31	0.8856
AT3G13980			unknown protein		Potri.006G144700 [exp]	4.89	0.8657
AT1G43850		SEU	SEUSS transcriptional co-regul...		Potri.010G052150 [exp]	6.32	0.8722
AT5G37830		OXP1	oxoprolinase 1 (.1)		Potri.017G124400 [exp]	12.64	0.8402
AT3G42170			BED zinc finger ;hAT family di...		Potri.018G126500 [exp]	13.63	0.8263
AT5G51280			DEAD-box protein abstrakt, put...		Potri.005G047301 [exp]	14.42	0.8442
AT5G25800			Polynucleotidyl transferase, r...		Potri.002G073300 [exp]	15.87	0.8521
AT5G14950		GMII, ATGMII	golgi alpha-mannosidase II (.1...		Potri.008G117400 [exp]	17.66	0.8342
AT4G32630			ArfGap/RecO-like zinc finger d...		Potri.006G246100 [exp]	19.07	0.8311
AT1G43850		SEU	SEUSS transcriptional co-regul...		Potri.013G089900 [exp]	19.33	0.7631

Compare expression of checked genes

Potri.001G355900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.