Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G24180 121 / 5e-33 CYP71B6 cytochrome p450 71b6 (.1) AT3G26280 121 / 5e-33 CYP71B4 "cytochrome P450, family 71, subfamily B, polypeptide 4", cytochrome P450, family 71, subfamily B, polypeptide 4 (.1) AT5G25130 117 / 1e-31 CYP71B12 "cytochrome P450, family 71, subfamily B, polypeptide 12", cytochrome P450, family 71, subfamily B, polypeptide 12 (.1) AT3G26300 116 / 3e-31 CYP71B34 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) AT3G26270 116 / 3e-31 CYP71B25 "cytochrome P450, family 71, subfamily B, polypeptide 25", cytochrome P450, family 71, subfamily B, polypeptide 25 (.1) AT5G25120 115 / 6e-31 CYP71B11 "ytochrome p450, family 71, subfamily B, polypeptide 11", ytochrome p450, family 71, subfamily B, polypeptide 11 (.1) AT1G13110 113 / 3e-30 CYP71B7 "cytochrome P450, family 71 subfamily B, polypeptide 7", cytochrome P450, family 71 subfamily B, polypeptide 7 (.1) AT5G25140 112 / 7e-30 CYP71B13 "cytochrome P450, family 71, subfamily B, polypeptide 13", cytochrome P450, family 71, subfamily B, polypeptide 13 (.1) AT3G26830 112 / 9e-30 CYP71B15, PAD3 PHYTOALEXIN DEFICIENT 3, Cytochrome P450 superfamily protein (.1) AT3G48280 112 / 1e-29 CYP71A25 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G364600 [exp] 286 / 3e-96 AT5G25120 352 / 2e-116 "ytochrome p450, family 71, subfamily B, polypeptide 11", ytochrome p450, family 71, subfamily B, polypeptide 11 (.1) Potri.001G365432 [exp] 257 / 4e-89 AT2G24180 142 / 2e-40 cytochrome p450 71b6 (.1) Potri.001G365100 [exp] 264 / 1e-87 AT3G26300 347 / 2e-114 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.007G074300 [exp] 180 / 3e-55 AT3G26300 343 / 6e-113 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.011G131051 [exp] 166 / 6e-51 AT3G48280 218 / 9e-67 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Potri.011G130850 [exp] 168 / 9e-51 AT3G26300 361 / 5e-120 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.011G130800 [exp] 167 / 2e-50 AT3G26300 359 / 4e-119 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.008G223500 [exp] 163 / 9e-49 AT3G26300 395 / 3e-133 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.007G074850 [exp] 159 / 2e-47 AT3G26300 379 / 1e-126 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019157 [exp] 160 / 2e-47 AT3G48300 358 / 1e-118 "cytochrome P450, family 71, subfamily A, polypeptide 23", cytochrome P450, family 71, subfamily A, polypeptide 23 (.1) Lus10002885 [exp] 160 / 2e-47 AT3G48280 396 / 2e-133 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Lus10026252 [exp] 151 / 3e-43 AT5G25120 383 / 2e-123 "ytochrome p450, family 71, subfamily B, polypeptide 11", ytochrome p450, family 71, subfamily B, polypeptide 11 (.1) Lus10019159 [exp] 147 / 1e-42 AT3G26330 365 / 1e-121 "cytochrome P450, family 71, subfamily B, polypeptide 37", cytochrome P450, family 71, subfamily B, polypeptide 37 (.1) Lus10009903 [exp] 146 / 3e-42 AT5G57260 376 / 1e-125 "cytochrome P450, family 71, subfamily B, polypeptide 10", cytochrome P450, family 71, subfamily B, polypeptide 10 (.1) Lus10030924 [exp] 138 / 3e-39 AT3G26300 391 / 2e-131 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Lus10030708 [exp] 137 / 5e-39 AT3G26210 390 / 6e-131 "cytochrome P450, family 71, subfamily B, polypeptide 23", cytochrome P450, family 71, subfamily B, polypeptide 23 (.1) Lus10040120 [exp] 137 / 1e-38 AT3G48280 377 / 5e-126 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Lus10030530 [exp] 133 / 1e-38 AT3G48310 191 / 1e-56 "cytochrome P450, family 71, subfamily A, polypeptide 22", cytochrome P450, family 71, subfamily A, polypeptide 22 (.1) Lus10012879 [exp] 135 / 4e-38 AT3G26330 409 / 6e-138 "cytochrome P450, family 71, subfamily B, polypeptide 37", cytochrome P450, family 71, subfamily B, polypeptide 37 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [poplar] [flax] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Potri.001G365001.1 pacid=42789099 polypeptide=Potri.001G365001.1.p locus=Potri.001G365001 ID=Potri.001G365001.1.v4.1 annot-version=v4.1 ATGGAGCAGCCTCAAATTCCCTCCTGCTTGGTCCTTCTCCCATCACTCCTCTTTATCTTCATGGTATTAAGGATGCTCAAAAAGTCGAAAACCAAAGACT TAACTCCAAATCTACCTCCAGGTCCACGGAAGCTGCCTGTGATAGGAAACTTGCACCAGTTATTTGGTTCTCTACCCCATCACCGCCTGCGAGACTTGGC CGAGAAACACGGACCTATCATGCACCTTCAACTCGGCCAAGTTCAGACCATTGTTATTTCTTCTCCAGAAACTGCTGAACAAGTGATGAAAGTCCATGAT ATCAACTTTGCTCATAGGCCCCATCTCCTTGTAGGACAAATCATCTTTTATAACTGCACAGACATAGCGACTGCAGCATATGGAGACTACTGGAGGCAGT TGCGGAAAATTTCCATCTTGGAGCTATGA
AA sequence Show only first row Show all	>Potri.001G365001.1 pacid=42789099 polypeptide=Potri.001G365001.1.p locus=Potri.001G365001 ID=Potri.001G365001.1.v4.1 annot-version=v4.1 MEQPQIPSCLVLLPSLLFIFMVLRMLKKSKTKDLTPNLPPGPRKLPVIGNLHQLFGSLPHHRLRDLAEKHGPIMHLQLGQVQTIVISSPETAEQVMKVHD INFAHRPHLLVGQIIFYNCTDIATAAYGDYWRQLRKISILEL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G24180		CYP71B6	cytochrome p450 71b6 (.1)		Potri.001G365001 [exp]	0	1
AT3G26230		CYP71B24	"cytochrome P450, family 71, s...		Potri.001G365366 [exp]	2.00	0.8784
AT2G24180		CYP71B6	cytochrome p450 71b6 (.1)		Potri.001G365432 [exp]	4.00	0.8046
AT3G26300		CYP71B34	"cytochrome P450, family 71, s...		Potri.001G365300 [exp]	7.74	0.7860
AT5G25120		CYP71B11	"ytochrome p450, family 71, su...		Potri.001G364600 [exp]	31.49	0.7819
AT5G59520		ZIP2	ZRT/IRT-like protein 2 (.1)		Potri.009G034600 [exp]	47.11	0.6497
AT4G17080			Histone H3 K4-specific methylt...		Potri.014G052300 [exp]	48.78	0.6655
					Potri.016G103700 [exp]	60.00	0.6941
AT2G41900	C3HZnF	OXS2	OXIDATIVE STRESS 2, CCCH-type ...		Potri.016G053700 [exp]	75.92	0.6454
AT4G27950	AP2_ERF	CRF4	cytokinin response factor 4 (....		Potri.013G158500 [exp]	95.62	0.6499
AT3G59940			Galactose oxidase/kelch repeat...		Potri.007G147000 [exp]	225.88	0.6010

Compare expression of checked genes

Potri.001G365001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.