Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G24180 144 / 9e-41 CYP71B6 cytochrome p450 71b6 (.1) AT3G26280 141 / 6e-40 CYP71B4 "cytochrome P450, family 71, subfamily B, polypeptide 4", cytochrome P450, family 71, subfamily B, polypeptide 4 (.1) AT5G25130 137 / 2e-38 CYP71B12 "cytochrome P450, family 71, subfamily B, polypeptide 12", cytochrome P450, family 71, subfamily B, polypeptide 12 (.1) AT3G26270 136 / 4e-38 CYP71B25 "cytochrome P450, family 71, subfamily B, polypeptide 25", cytochrome P450, family 71, subfamily B, polypeptide 25 (.1) AT5G25120 134 / 3e-37 CYP71B11 "ytochrome p450, family 71, subfamily B, polypeptide 11", ytochrome p450, family 71, subfamily B, polypeptide 11 (.1) AT5G25140 134 / 4e-37 CYP71B13 "cytochrome P450, family 71, subfamily B, polypeptide 13", cytochrome P450, family 71, subfamily B, polypeptide 13 (.1) AT1G13090 132 / 2e-36 CYP71B28 "cytochrome P450, family 71, subfamily B, polypeptide 28", cytochrome P450, family 71, subfamily B, polypeptide 28 (.1) AT1G13110 132 / 2e-36 CYP71B7 "cytochrome P450, family 71 subfamily B, polypeptide 7", cytochrome P450, family 71 subfamily B, polypeptide 7 (.1) AT5G25180 130 / 9e-36 CYP71B14 "cytochrome P450, family 71, subfamily B, polypeptide 14", cytochrome P450, family 71, subfamily B, polypeptide 14 (.1) AT3G26180 127 / 1e-34 CYP71B20 "cytochrome P450, family 71, subfamily B, polypeptide 20", cytochrome P450, family 71, subfamily B, polypeptide 20 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G364600 [exp] 279 / 1e-92 AT5G25120 352 / 2e-116 "ytochrome p450, family 71, subfamily B, polypeptide 11", ytochrome p450, family 71, subfamily B, polypeptide 11 (.1) Potri.001G365100 [exp] 275 / 2e-91 AT3G26300 347 / 2e-114 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.001G365001 [exp] 247 / 5e-85 AT2G24180 121 / 3e-33 cytochrome p450 71b6 (.1) Potri.007G074300 [exp] 194 / 7e-60 AT3G26300 343 / 6e-113 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.011G131051 [exp] 188 / 3e-59 AT3G48280 218 / 9e-67 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Potri.011G130850 [exp] 189 / 4e-58 AT3G26300 361 / 5e-120 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.011G130800 [exp] 189 / 8e-58 AT3G26300 359 / 4e-119 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.008G223500 [exp] 184 / 3e-56 AT3G26300 395 / 3e-133 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Potri.007G074850 [exp] 178 / 7e-54 AT3G26300 379 / 1e-126 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002885 [exp] 174 / 5e-52 AT3G48280 396 / 2e-133 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1) Lus10019157 [exp] 172 / 3e-51 AT3G48300 358 / 1e-118 "cytochrome P450, family 71, subfamily A, polypeptide 23", cytochrome P450, family 71, subfamily A, polypeptide 23 (.1) Lus10026252 [exp] 170 / 3e-49 AT5G25120 383 / 2e-123 "ytochrome p450, family 71, subfamily B, polypeptide 11", ytochrome p450, family 71, subfamily B, polypeptide 11 (.1) Lus10009903 [exp] 164 / 3e-48 AT5G57260 376 / 1e-125 "cytochrome P450, family 71, subfamily B, polypeptide 10", cytochrome P450, family 71, subfamily B, polypeptide 10 (.1) Lus10016601 [exp] 159 / 1e-46 AT3G26320 402 / 6e-136 "cytochrome P450, family 71, subfamily B, polypeptide 36", cytochrome P450, family 71, subfamily B, polypeptide 36 (.1) Lus10030708 [exp] 159 / 3e-46 AT3G26210 390 / 6e-131 "cytochrome P450, family 71, subfamily B, polypeptide 23", cytochrome P450, family 71, subfamily B, polypeptide 23 (.1) Lus10030924 [exp] 157 / 1e-45 AT3G26300 391 / 2e-131 "cytochrome P450, family 71, subfamily B, polypeptide 34", cytochrome P450, family 71, subfamily B, polypeptide 34 (.1) Lus10030530 [exp] 151 / 7e-45 AT3G48310 191 / 1e-56 "cytochrome P450, family 71, subfamily A, polypeptide 22", cytochrome P450, family 71, subfamily A, polypeptide 22 (.1) Lus10012879 [exp] 153 / 4e-44 AT3G26330 409 / 6e-138 "cytochrome P450, family 71, subfamily B, polypeptide 37", cytochrome P450, family 71, subfamily B, polypeptide 37 (.1) Lus10040120 [exp] 150 / 8e-43 AT3G48280 377 / 5e-126 "cytochrome P450, family 71, subfamily A, polypeptide 25", cytochrome P450, family 71, subfamily A, polypeptide 25 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [poplar] [flax] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Potri.001G365432.1 pacid=42790632 polypeptide=Potri.001G365432.1.p locus=Potri.001G365432 ID=Potri.001G365432.1.v4.1 annot-version=v4.1 ATGGAGCAGCTTCAAATTCCCTCCTCCTTGGTCCTTCTCCCATCACTCCTCTTTATCTTCATGGTATTAAGGATGCTCAAAAAGTCGAAAACCAAAGACT TGACTCCAAATCTACCTCCAGGTCCACGGAAGCTGCCTGTGATAGGAAACTTGCACCAGTTATTTGGTTCTCTACCCCATCACCACCTGCGAGACTTGGC CGAGAAACACGGACCTATCATGCACCTTCAACTCGGCCAAGTTCAGACCATTGTTATTTCTTCTCCAGAAACTGCTGAACAAGTGATGAAAGTCCATGAT ATCAACTTTGTTCATAGGCCCCATCTCCTTGTAGGACAAATCATCTTTTATAACTGCACAGACATAGTGAATGCAGCATATGGAGACTACTGGAGGCAGT TGCGGAAAATTTCCATCTTGGAGCTATTAAGTGCTAAACGTGTGCAATCATTTAGATCTATCAGGGAGGAAGAGGTATCCAGTCTTATTGGAAGTATTTC TTCCAGTGCAGGATCAATAGTCAACCTTAGCAGGATGCTGTTTTCTGTAGCATAA
AA sequence Show only first row Show all	>Potri.001G365432.1 pacid=42790632 polypeptide=Potri.001G365432.1.p locus=Potri.001G365432 ID=Potri.001G365432.1.v4.1 annot-version=v4.1 MEQLQIPSSLVLLPSLLFIFMVLRMLKKSKTKDLTPNLPPGPRKLPVIGNLHQLFGSLPHHHLRDLAEKHGPIMHLQLGQVQTIVISSPETAEQVMKVHD INFVHRPHLLVGQIIFYNCTDIVNAAYGDYWRQLRKISILELLSAKRVQSFRSIREEEVSSLIGSISSSAGSIVNLSRMLFSVA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G24180		CYP71B6	cytochrome p450 71b6 (.1)		Potri.001G365432 [exp]	0	1
AT2G24180		CYP71B6	cytochrome p450 71b6 (.1)		Potri.001G365001 [exp]	4.00	0.8046
AT3G26230		CYP71B24	"cytochrome P450, family 71, s...		Potri.001G365366 [exp]	4.00	0.8316
AT1G68795		CLE12	CLAVATA3/ESR-RELATED 12 (.1)		Potri.012G059600 [exp]	14.14	0.7221
AT1G29860	WRKY	ATWRKY71, WRKY7...	WRKY DNA-binding protein 71 (....		Potri.011G079300 [exp]	17.02	0.6917
AT4G37370		CYP81D8	"cytochrome P450, family 81, s...		Potri.007G049900 [exp]	25.25	0.6579	IFS1.30
AT4G28530	NAC	ANAC074	NAC domain containing protein ...		Potri.005G225800 [exp]	27.38	0.7088
AT3G26300		CYP71B34	"cytochrome P450, family 71, s...		Potri.001G365300 [exp]	29.15	0.6382
AT1G61560		ATMLO6, MLO6	MILDEW RESISTANCE LOCUS O 6, S...		Potri.016G088000 [exp]	40.81	0.6843
AT3G59850			Pectin lyase-like superfamily ...		Potri.007G144400 [exp]	40.98	0.6298
AT2G33770		ATUBC24, UBC24,...	UBIQUITIN-CONJUGATING ENZYME 2...		Potri.004G043500 [exp]	62.73	0.6754

Compare expression of checked genes

Potri.001G365432 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.