Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G13140 79 / 4e-18 hydroxyproline-rich glycoprotein family protein (.1) AT3G06130 72 / 8e-15 Heavy metal transport/detoxification superfamily protein (.1.2) AT3G05220 69 / 1e-13 Heavy metal transport/detoxification superfamily protein (.1.2) AT5G19090 69 / 2e-13 Heavy metal transport/detoxification superfamily protein (.1.2.3) AT1G56210 62 / 4e-11 Heavy metal transport/detoxification superfamily protein (.1) AT5G27690 61 / 7e-11 Heavy metal transport/detoxification superfamily protein (.1) AT4G23882 57 / 1e-09 Heavy metal transport/detoxification superfamily protein (.1) AT1G23000 57 / 2e-09 Heavy metal transport/detoxification superfamily protein (.1) AT5G37860 52 / 5e-08 Heavy metal transport/detoxification superfamily protein (.1) AT4G10465 49 / 5e-07 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G128400 [exp] 67 / 5e-13 AT1G23000 137 / 1e-36 Heavy metal transport/detoxification superfamily protein (.1) Potri.010G114300 [exp] 67 / 1e-12 AT1G23000 128 / 2e-33 Heavy metal transport/detoxification superfamily protein (.1) Potri.008G202800 [exp] 66 / 1e-12 AT3G06130 150 / 6e-41 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.010G024700 [exp] 59 / 4e-10 AT5G27690 114 / 2e-29 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G036300 [exp] 58 / 6e-10 AT3G06130 114 / 7e-28 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.014G132000 [exp] 54 / 1e-08 AT5G27690 114 / 4e-29 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G026100 [exp] 54 / 1e-08 AT5G27690 100 / 3e-24 Heavy metal transport/detoxification superfamily protein (.1) Potri.002G032800 [exp] 52 / 1e-08 AT3G05920 52 / 2e-09 Heavy metal transport/detoxification superfamily protein (.1) Potri.002G011500 [exp] 51 / 4e-08 AT3G51020 71 / 3e-16 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041228 [exp] 69 / 1e-13 AT3G06130 149 / 3e-41 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10004465 [exp] 67 / 6e-13 AT5G19090 122 / 2e-30 Heavy metal transport/detoxification superfamily protein (.1.2.3) Lus10029942 [exp] 67 / 8e-13 AT5G19090 125 / 1e-31 Heavy metal transport/detoxification superfamily protein (.1.2.3) Lus10032445 [exp] 64 / 8e-12 AT1G23000 129 / 2e-34 Heavy metal transport/detoxification superfamily protein (.1) Lus10031514 [exp] 59 / 5e-10 AT5G19090 118 / 1e-28 Heavy metal transport/detoxification superfamily protein (.1.2.3) Lus10009116 [exp] 58 / 8e-10 AT2G02000 248 / 3e-75 glutamate decarboxylase 3 (.1) Lus10031495 [exp] 56 / 3e-09 AT5G27690 124 / 2e-32 Heavy metal transport/detoxification superfamily protein (.1) Lus10015174 [exp] 55 / 8e-09 AT5G27690 124 / 2e-32 Heavy metal transport/detoxification superfamily protein (.1) Lus10028529 [exp] 52 / 5e-08 AT1G23000 81 / 4e-17 Heavy metal transport/detoxification superfamily protein (.1) Lus10042946 [exp] 44 / 1e-05 AT1G71050 196 / 3e-65 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [poplar] [flax] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Potri.001G366600.2 pacid=42789287 polypeptide=Potri.001G366600.2.p locus=Potri.001G366600 ID=Potri.001G366600.2.v4.1 annot-version=v4.1 ATGTTTCTGGTATTAAATCTCTTCTTCTCCCTCAAGAAACTTTGTTCCAAGTCTGCTGGAAAAAAAAATACACAGCATTGTTCCAAGTACCTTCAAATGG ACTCCAATGCACAGATGAGTTGTATGATGAGAGTGGATGTCCATTGTGATGGGTGTAAAAGGCAAATGATGGAAGTGTTACAGAATCTAAAAGGAGTATA TTCTGTGGTTCTAGATGCAGAACAAGGGACAGTGAAGGTCATTGGAAAAGTAAATCCCACAACAATTTTGAATGTCTTTGATAAATATGGGAAACATGGA GAGGTCTCATCTCTTAGGTTTGATGGTGAGGTCATGGAACAAATACCTTATTCATTTTATGGAGATAATCCTTATAATCCACATGAGGTACCATACCCTC CAATTCCAATTCCAATTCCATATCATTTCTTTAGAGGGCCAGAACAACAATTGTATGGGAGAAATCCGTATCCAATGCCACCGCCTCTGCTAGGGACAAT GCCACCGCCTCCATGGCCTCCACCACCACAGCAGTATCCACCACCACCTCCTCTACCACAGCATCAACAGCAGCAGCAGCCATCACCAGTCAGTAAAGCT CCATCAGCACCGCCAGCACCCCTTCCACCTGACCCTAAATGTTGCACCATAATGTGA
AA sequence Show only first row Show all	>Potri.001G366600.2 pacid=42789287 polypeptide=Potri.001G366600.2.p locus=Potri.001G366600 ID=Potri.001G366600.2.v4.1 annot-version=v4.1 MFLVLNLFFSLKKLCSKSAGKKNTQHCSKYLQMDSNAQMSCMMRVDVHCDGCKRQMMEVLQNLKGVYSVVLDAEQGTVKVIGKVNPTTILNVFDKYGKHG EVSSLRFDGEVMEQIPYSFYGDNPYNPHEVPYPPIPIPIPYHFFRGPEQQLYGRNPYPMPPPLLGTMPPPPWPPPPQQYPPPPPLPQHQQQQQPSPVSKA PSAPPAPLPPDPKCCTIM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G13140			hydroxyproline-rich glycoprote...		Potri.001G366600 [exp]	0	1
AT1G75810			unknown protein		Potri.005G241200 [exp]	2.00	0.7628
AT1G78070			Transducin/WD40 repeat-like su...		Potri.005G168600 [exp]	7.93	0.6936
					Potri.019G120050 [exp]	14.49	0.7442
AT5G16490		RIC4	ROP-interactive CRIB motif-con...		Potri.013G086600 [exp]	22.44	0.7068
AT5G60020		LAC17, ATLAC17	laccase 17 (.1)		Potri.001G054600 [exp]	30.78	0.7274
AT1G10240	FAR1_related	FRS11	FAR1-related sequence 11 (.1)		Potri.010G140500 [exp]	31.00	0.6466
AT5G44740		POLH	Y-family DNA polymerase H (.1....		Potri.003G152600 [exp]	33.98	0.7117
AT5G50170			C2 calcium/lipid-binding and G...		Potri.015G083500 [exp]	38.10	0.6456
AT2G02970			GDA1/CD39 nucleoside phosphata...		Potri.008G086400 [exp]	55.89	0.6349
AT1G15780			unknown protein		Potri.003G025500 [exp]	60.33	0.6544

Compare expression of checked genes

Potri.001G366600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.