Potri.001G370366 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G13200 247 / 6e-83 EMB2769 EMBRYO DEFECTIVE 2769, Cwf15 / Cwc15 cell cycle control family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016651 272 / 9e-93 AT3G13200 311 / 3e-108 EMBRYO DEFECTIVE 2769, Cwf15 / Cwc15 cell cycle control family protein (.1)
Lus10022566 269 / 1e-91 AT3G13200 307 / 1e-106 EMBRYO DEFECTIVE 2769, Cwf15 / Cwc15 cell cycle control family protein (.1)
Lus10018143 67 / 6e-14 AT3G13200 72 / 2e-16 EMBRYO DEFECTIVE 2769, Cwf15 / Cwc15 cell cycle control family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04889 Cwf_Cwc_15 Cwf15/Cwc15 cell cycle control protein
Representative CDS sequence
>Potri.001G370366.1 pacid=42788537 polypeptide=Potri.001G370366.1.p locus=Potri.001G370366 ID=Potri.001G370366.1.v4.1 annot-version=v4.1
ATGACAACTGCAGCTAGACCTACATGGGCTCCTGCAAAAGGTGGTAATGAACAAGGTGGGACTCGTATTTTCGGCCCATCTCAGAAGTATTCGTCAAGGG
ATCTTGCTGCTCATACCACTCTAAAACCAAGAAAGGAAGGGCAAGACACCAAGGAGGAATTGCTGAAGAGGAATCTCCGTGAGGAGTTGGAAGAGCGTGA
GCGGAGGCATTTCTCATCAAAGGATAAGTCTTACAATGATGACAGAGATCGTAGAAAGGGTAATCATCTTCTCTTGGAAGGGACAAAGAGGGACACTGAA
GATCGTATCATCCCACGAAGTGTGGATGCTGATGATTCTGATGTGGAAGTTAACAATGATGATGATAGTGATGACGACGACGACGACGACGAGGATGACA
CAGAAGCTCTCATGGCTGAGCTTGAACGAATAAAGAAGGAAAGAGCAGAGGAGAAGCTCCGGCAGGATCAACTACAAGTAGCTGAAGAGCTTAAAGCCAA
GGAAGAGCAGCTTCTTAGAGGAAATCCACTGTTGAATAATACAACCACCACCTTTAACGTGAAAAGAAGGTGGGATGATGATGTGGTCTTCAAGAACCAG
GCTCGAGGTGAAACAAAGACTCCTAAGCGCTTCATCAATGACACCATTAGGAATGACTTCCACCGAAAATTCCTGCAGAAATACATGAAATAA
AA sequence
>Potri.001G370366.1 pacid=42788537 polypeptide=Potri.001G370366.1.p locus=Potri.001G370366 ID=Potri.001G370366.1.v4.1 annot-version=v4.1
MTTAARPTWAPAKGGNEQGGTRIFGPSQKYSSRDLAAHTTLKPRKEGQDTKEELLKRNLREELEERERRHFSSKDKSYNDDRDRRKGNHLLLEGTKRDTE
DRIIPRSVDADDSDVEVNNDDDSDDDDDDDEDDTEALMAELERIKKERAEEKLRQDQLQVAEELKAKEEQLLRGNPLLNNTTTTFNVKRRWDDDVVFKNQ
ARGETKTPKRFINDTIRNDFHRKFLQKYMK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G13200 EMB2769 EMBRYO DEFECTIVE 2769, Cwf15 /... Potri.001G370366 0 1
AT2G43810 Small nuclear ribonucleoprotei... Potri.010G178700 5.19 0.8784
AT5G43210 Excinuclease ABC, C subunit, N... Potri.001G260600 5.83 0.8907
AT5G42300 UBL5 ubiquitin-like protein 5 (.1) Potri.010G223100 8.77 0.8425
AT3G53120 VPS37-1 Modifier of rudimentary (Mod(r... Potri.016G097000 10.39 0.8149
AT1G75510 Transcription initiation facto... Potri.005G233800 10.58 0.8771
Potri.001G077600 12.12 0.8602
AT5G23090 CCAAT NF-YB13 "nuclear factor Y, subunit B13... Potri.012G058200 13.41 0.8202 Pt-DR1.2
AT5G53330 Ubiquitin-associated/translati... Potri.015G023600 13.56 0.8579
AT4G08550 electron carriers;protein disu... Potri.002G091200 13.78 0.8097
AT2G19270 unknown protein Potri.006G075000 15.65 0.8640

Potri.001G370366 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.