Potri.001G371400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G55980 50 / 3e-08 serine-rich protein-related (.1)
AT1G67910 46 / 6e-07 unknown protein
AT3G13227 44 / 5e-06 serine-rich protein-related (.1)
AT5G20370 41 / 0.0001 serine-rich protein-related (.1)
AT1G24577 39 / 0.0002 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G186200 47 / 3e-07 AT1G67910 85 / 4e-23 unknown protein
Potri.010G046700 44 / 5e-06 AT1G67910 82 / 4e-22 unknown protein
Potri.018G079200 43 / 6e-06 AT1G67910 45 / 9e-08 unknown protein
Potri.006G060800 41 / 0.0002 AT5G25280 130 / 2e-37 serine-rich protein-related (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008880 57 / 1e-10 AT5G55980 63 / 1e-13 serine-rich protein-related (.1)
Lus10023227 55 / 5e-10 AT5G55980 69 / 3e-16 serine-rich protein-related (.1)
Lus10034901 43 / 1e-05 AT1G67910 49 / 6e-09 unknown protein
Lus10023632 42 / 1e-05 AT1G67910 48 / 1e-08 unknown protein
Lus10043215 41 / 3e-05 AT5G55980 44 / 8e-07 serine-rich protein-related (.1)
Lus10011094 41 / 4e-05 AT5G55980 44 / 1e-06 serine-rich protein-related (.1)
Lus10039998 39 / 0.0006 AT5G25280 157 / 3e-48 serine-rich protein-related (.1.2)
Lus10000442 38 / 0.0006 AT1G67910 56 / 1e-11 unknown protein
Lus10026701 37 / 0.0006 AT1G67910 56 / 5e-12 unknown protein
Lus10008808 39 / 0.0007 AT5G25280 153 / 2e-46 serine-rich protein-related (.1.2)
PFAM info
Representative CDS sequence
>Potri.001G371400.2 pacid=42790965 polypeptide=Potri.001G371400.2.p locus=Potri.001G371400 ID=Potri.001G371400.2.v4.1 annot-version=v4.1
ATGTTCATATTGCCCATTTTGATATTTTTAATTATCCTCCCCATTGCAGAAGCAGAAAGCTCAAATATCTCTCGTCTGTGCCTTCTCTCCCTTCTCAGGT
CACCGGTTGGCTGGCGACAAACCAGAAAAGTTCCTTTCTCTATTGAATTGTCAGAAAAGCTTTCGAAAAGATCAAAGATGAGTAATAAGAGCAACAGCGT
GAGGGACCAGAAACCCTCAAAAATCCTTAAGAAGCAACAGCAAGTAACCCCTGAAATAATGGCATCAGCAATTGACATGGAAGTGCTGAAGAAGAAGTCA
CCGCTACACAATCCTGGCACTTCGCCAAGGTTACACAGGGCCTTGACAAAACCACGGAGCACTGAACGGGGGAACTGTCTTTGCTCACCGACCACCCATG
CCGGTTCCTTCAAGTGCCGATTCCACCGGAGCTCCGGCATGATTCGTGGAGGATCCATCGGATCCAATCTCTCCGAGTTGGATGGTAAATCACGTGCTAT
TAGCGACCTGGTTTAG
AA sequence
>Potri.001G371400.2 pacid=42790965 polypeptide=Potri.001G371400.2.p locus=Potri.001G371400 ID=Potri.001G371400.2.v4.1 annot-version=v4.1
MFILPILIFLIILPIAEAESSNISRLCLLSLLRSPVGWRQTRKVPFSIELSEKLSKRSKMSNKSNSVRDQKPSKILKKQQQVTPEIMASAIDMEVLKKKS
PLHNPGTSPRLHRALTKPRSTERGNCLCSPTTHAGSFKCRFHRSSGMIRGGSIGSNLSELDGKSRAISDLV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G55980 serine-rich protein-related (.... Potri.001G371400 0 1
AT5G65180 ENTH/VHS family protein (.1.2) Potri.007G086750 1.41 0.9003
AT2G20430 RIC6 ROP-interactive CRIB motif-con... Potri.002G035500 4.58 0.9027
AT2G16230 O-Glycosyl hydrolases family 1... Potri.014G184900 9.00 0.8940
Potri.008G130950 9.16 0.8757
AT1G64065 Late embryogenesis abundant (L... Potri.001G098200 9.43 0.7179
AT5G42720 Glycosyl hydrolase family 17 p... Potri.014G183000 10.00 0.8939
AT2G16230 O-Glycosyl hydrolases family 1... Potri.014G182800 11.40 0.8844
AT2G16230 O-Glycosyl hydrolases family 1... Potri.014G182166 11.61 0.8694
AT2G16230 O-Glycosyl hydrolases family 1... Potri.014G183500 14.49 0.8754
AT1G61330 FBD, F-box and Leucine Rich Re... Potri.011G042900 17.49 0.8564

Potri.001G371400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.