Plant FIBer expression Database

Potri.001G371850 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G204350
[exp]
49 / 1e-07 ATMG00750 45 / 9e-06 GAG/POL/ENV polyprotein (.1)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.001G371850.4 pacid=42791586 polypeptide=Potri.001G371850.4.p locus=Potri.001G371850 ID=Potri.001G371850.4.v4.1 annot-version=v4.1
ATGAGAACAATTGTGGTCATCAGGCTAGCCGATCGATCAAATTGTTATCCAAAGGGCTTTAAGAAGGATGTTTTGGTGCCGGAAAATGAGTTGATATTTC
CGGCTGATTTCTCTGTTCTTGAAAGGAAAAAAGAGCCGATGCCTGCTAAATTGCTTCTCATGCTTGGACATCCATTTCTGACAATCACAGGGACGAGGAT
AGATGTCCTTGAAGAGACCTTAACCACGGATTCAACATATTCGAAGCAACGAGGTACCCAAACGATGTTTTTTCATGCTTTTATATTGATGTGTTCGATT
CATTTGTGCTGGATTTATTTAATCCAAGTATGA
AA sequence
>Potri.001G371850.4 pacid=42791586 polypeptide=Potri.001G371850.4.p locus=Potri.001G371850 ID=Potri.001G371850.4.v4.1 annot-version=v4.1
MRTIVVIRLADRSNCYPKGFKKDVLVPENELIFPADFSVLERKKEPMPAKLLLMLGHPFLTITGTRIDVLEETLTTDSTYSKQRGTQTMFFHAFILMCSI
HLCWIYLIQV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.001G371850
[exp]
0 1
AT5G48380 BIR1 BAK1-interacting receptor-like... Potri.017G004900
[exp]
1.00 0.9535
AT4G17880 bHLH bHLH004, MYC4 Basic helix-loop-helix (bHLH) ... Potri.002G176900
[exp]
1.41 0.9381
AT5G65280 GCL1 GCR2-like 1 (.1) Potri.007G096500
[exp]
2.82 0.9329
AT5G13220 ZIM JAS1, TIFY9, JA... TIFY DOMAIN PROTEIN 9, JASMONA... Potri.001G062500
[exp]
4.89 0.9377
AT3G48270 CYP71A26 "cytochrome P450, family 71, s... Potri.016G137600
[exp]
6.70 0.9320 CYP71AN3
AT5G36930 Disease resistance protein (TI... Potri.019G019053
[exp]
7.07 0.9135
AT5G47710 Calcium-dependent lipid-bindin... Potri.016G005300
[exp]
8.12 0.9279
Potri.006G128250
[exp]
12.84 0.9102
AT5G04760 MYB Duplicated homeodomain-like su... Potri.001G219100
[exp]
13.74 0.9146
AT1G72450 ZIM TIFY11B, JAZ6 TIFY DOMAIN PROTEIN 11B, jasmo... Potri.003G068900
[exp]
15.87 0.9251

Potri.001G371850 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.