Potri.001G375166 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G29110 53 / 4e-09 ATGLR2.8 glutamate receptor 2.8 (.1)
AT2G29120 48 / 2e-07 ATGLR2.7 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1)
AT2G29100 48 / 2e-07 ATGLR2.9 GLUTAMATE RECEPTOR 2.9, glutamate receptor 2.9 (.1)
AT3G07520 44 / 5e-06 ATGLR1.4 glutamate receptor 1.4 (.1)
AT2G24720 44 / 6e-06 ATGLR2.2 glutamate receptor 2.2 (.1)
AT3G04110 43 / 1e-05 ATGLR1.1, GLR1 glutamate receptor 1.1 (.1)
AT2G24710 41 / 5e-05 ATGLR2.3 glutamate receptor 2.3 (.1)
AT4G31710 40 / 0.0001 ATGLR2.4 ARABIDOPSIS THALIANA GLUTAMATE RECEPTOR 2.4, glutamate receptor 2.4 (.1)
AT5G27100 40 / 0.0001 ATGLR2.1 ARABIDOPSIS THALIANA GLUTAMATE RECEPTOR 2.1, glutamate receptor 2.1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G375100 219 / 3e-68 AT2G29120 419 / 3e-132 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1)
Potri.001G375000 218 / 1e-67 AT2G29120 415 / 1e-130 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1)
Potri.001G374700 210 / 7e-65 AT2G29120 446 / 1e-142 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1)
Potri.001G374800 210 / 8e-65 AT2G29120 426 / 6e-135 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1)
Potri.001G374600 202 / 3e-62 AT2G29120 452 / 9e-145 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1)
Potri.001G374300 99 / 2e-25 AT2G29120 422 / 1e-133 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1)
Potri.001G375200 98 / 6e-25 AT2G29120 436 / 8e-139 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1)
Potri.011G063050 58 / 3e-11 AT2G29110 51 / 1e-07 glutamate receptor 2.8 (.1)
Potri.007G044000 59 / 4e-11 AT2G29110 308 / 6e-93 glutamate receptor 2.8 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038670 68 / 2e-14 AT3G10490 441 / 5e-143 Arabidopsis NAC domain containing protein 51, NAC domain containing protein 52 (.1.2)
Lus10026235 42 / 3e-05 AT2G29120 912 / 0.0 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1)
Lus10013952 40 / 0.0002 AT2G29120 377 / 1e-116 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1)
Lus10013976 40 / 0.0002 AT2G29110 372 / 1e-114 glutamate receptor 2.8 (.1)
Lus10003436 39 / 0.0002 AT2G29120 867 / 0.0 GLUTAMATE RECEPTOR 2.7, glutamate receptor 2.7 (.1)
PFAM info
Representative CDS sequence
>Potri.001G375166.1 pacid=42793230 polypeptide=Potri.001G375166.1.p locus=Potri.001G375166 ID=Potri.001G375166.1.v4.1 annot-version=v4.1
ATGGGTACTTTGCCTCACGCCTTCTCGTTGTTCGCTCTAATTTTGCTCTTGACATCCGGTACAGGAGCCGATCAAATTACCAAGACACAGGCTATTTTCA
ATGGAAGCACTGGAATAGGAGCTATTGTGGATACAAGTTCCCGTATTGGCAAAGAAGAAATAGTAGCGATGGAAGTTGCAAAGGAGGATTTCTATGGCTT
CGGAAATCTAACATTTTTGCTTATAAATGACTCTCAAAAGGATACCATCCATGCAGCTCTTGAAGCTAAGGATCTTATCGACACACGACAAGTACAAGCC
ATTATAGGACCACAGACATGGAAGAGGTGTCATTAG
AA sequence
>Potri.001G375166.1 pacid=42793230 polypeptide=Potri.001G375166.1.p locus=Potri.001G375166 ID=Potri.001G375166.1.v4.1 annot-version=v4.1
MGTLPHAFSLFALILLLTSGTGADQITKTQAIFNGSTGIGAIVDTSSRIGKEEIVAMEVAKEDFYGFGNLTFLLINDSQKDTIHAALEAKDLIDTRQVQA
IIGPQTWKRCH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G29110 ATGLR2.8 glutamate receptor 2.8 (.1) Potri.001G375166 0 1
AT2G29120 ATGLR2.7 GLUTAMATE RECEPTOR 2.7, gluta... Potri.001G375100 1.73 0.9999
AT2G29120 ATGLR2.7 GLUTAMATE RECEPTOR 2.7, gluta... Potri.001G375000 2.44 0.9999
AT5G11210 ATGLR2.5 ARABIDOPSIS THALIANA GLU, glut... Potri.001G375133 3.00 0.9999
Potri.015G034166 4.00 0.9995
AT2G29120 ATGLR2.7 GLUTAMATE RECEPTOR 2.7, gluta... Potri.001G374700 5.47 0.9990
AT2G29120 ATGLR2.7 GLUTAMATE RECEPTOR 2.7, gluta... Potri.001G374800 8.12 0.9988
Potri.001G091400 8.48 0.9987
AT2G29120 ATGLR2.7 GLUTAMATE RECEPTOR 2.7, gluta... Potri.001G374600 8.83 0.9987
Potri.001G439900 12.24 0.9991
AT5G06740 Concanavalin A-like lectin pro... Potri.016G045000 14.49 0.9990

Potri.001G375166 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.