Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G31083 54 / 4e-11 AtCLE5, CLE5, CLE7 CLAVATA3/ESR-RELATED 5 (.1) AT2G31085 53 / 5e-11 AtCLE6, CLE6 CLAVATA3/ESR-RELATED 6 (.1) AT2G31082 44 / 2e-07 CLE7, CLE5 CLAVATA3/ESR-RELATED 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G096900 [exp] 94 / 4e-27 AT2G31083 49 / 4e-09 CLAVATA3/ESR-RELATED 5 (.1) Potri.019G090800 [exp] 57 / 3e-12 AT2G31083 60 / 1e-13 CLAVATA3/ESR-RELATED 5 (.1) Potri.011G063750 [exp] 55 / 1e-11 AT2G31083 45 / 5e-08 CLAVATA3/ESR-RELATED 5 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002196 [exp] 39 / 4e-05 AT2G31083 49 / 8e-09 CLAVATA3/ESR-RELATED 5 (.1) Lus10000464 [exp] 38 / 6e-05 AT2G31085 49 / 4e-09 CLAVATA3/ESR-RELATED 6 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G376200.1 pacid=42788083 polypeptide=Potri.001G376200.1.p locus=Potri.001G376200 ID=Potri.001G376200.1.v4.1 annot-version=v4.1 ATGGCAACTTTGATAAAAAAGAAGATATTGTTACTGTCCATGATTATAATAGTGATGCTTGTTGGGAGTTCTGATGCACGTTTTTCTCGTAAGTTTTCTA CCATGCCAAAGAAGTTCGAAAGCAGCCATATTTTACGTGAATTGGGGTACGATATGCCAAAAATTGAGTATTACAGAAGAAGGTGGATGTTAGACACCGA TAGACTCTCACCGGGAGGACCAGATCCTCAGCATCATTAA
AA sequence Show only first row Show all	>Potri.001G376200.1 pacid=42788083 polypeptide=Potri.001G376200.1.p locus=Potri.001G376200 ID=Potri.001G376200.1.v4.1 annot-version=v4.1 MATLIKKKILLLSMIIIVMLVGSSDARFSRKFSTMPKKFESSHILRELGYDMPKIEYYRRRWMLDTDRLSPGGPDPQHH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G31083		AtCLE5, CLE5, C...	CLAVATA3/ESR-RELATED 5 (.1)		Potri.001G376200 [exp]	0	1
AT3G55646			unknown protein		Potri.008G061700 [exp]	6.16	0.9363
AT4G21200		ATGA2OX8	ARABIDOPSIS THALIANA GIBBERELL...		Potri.011G134100 [exp]	9.16	0.8958
AT5G07440		GDH2	glutamate dehydrogenase 2 (.1....		Potri.015G111000 [exp]	10.24	0.9042
AT4G18250			receptor serine/threonine kina...		Potri.017G009600 [exp]	15.96	0.9257
					Potri.018G131900 [exp]	18.65	0.9138
AT4G13090		XTH2	xyloglucan endotransglucosylas...		Potri.002G244200 [exp]	22.97	0.8753	Pt-XTH2.1
AT4G38470		STY46	serine/threonine/tyrosine kina...		Potri.004G179514 [exp]	27.98	0.9176
					Potri.018G003650 [exp]	31.00	0.8939
AT2G36380		ABCG34, PDR6, A...	ATP-binding cassette G34, plei...		Potri.009G147100 [exp]	37.60	0.9196
AT1G10010		AAP8, ATAAP8	amino acid permease 8 (.1)		Potri.006G235901 [exp]	44.15	0.8754

Compare expression of checked genes

Potri.001G376200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.