Plant FIBer expression Database

RPB19.1 (Potri.001G377200) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol RPB19.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G59180 340 / 1e-121 NRPB7 DNA-directed RNA polymerase II (.1)
AT4G14660 77 / 7e-18 NRPE7 RNA polymerase Rpb7-like, N-terminal domain (.1)
AT3G22900 74 / 6e-17 NRPD7 RNA polymerase Rpb7-like, N-terminal domain (.1)
AT4G14520 52 / 2e-08 DNA-directed RNA polymerase II-related (.1.2.3)
AT1G06790 47 / 1e-06 RNA polymerase Rpb7 N-terminal domain-containing protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G161700
[exp]
79 / 1e-18 AT4G14660 293 / 5e-103 RNA polymerase Rpb7-like, N-terminal domain (.1)
Potri.010G077300
[exp]
78 / 2e-18 AT4G14660 261 / 3e-90 RNA polymerase Rpb7-like, N-terminal domain (.1)
Potri.010G077200
[exp]
72 / 6e-16 AT4G14660 171 / 1e-54 RNA polymerase Rpb7-like, N-terminal domain (.1)
Potri.002G044500
[exp]
42 / 4e-05 AT1G06790 228 / 1e-76 RNA polymerase Rpb7 N-terminal domain-containing protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001559
[exp]
340 / 2e-121 AT5G59180 331 / 5e-118 DNA-directed RNA polymerase II (.1)
Lus10004986
[exp]
333 / 7e-119 AT5G59180 325 / 2e-115 DNA-directed RNA polymerase II (.1)
Lus10023620
[exp]
73 / 2e-16 AT4G14660 205 / 3e-68 RNA polymerase Rpb7-like, N-terminal domain (.1)
Lus10023619
[exp]
72 / 1e-15 AT4G14660 266 / 2e-92 RNA polymerase Rpb7-like, N-terminal domain (.1)
Lus10024250
[exp]
70 / 4e-15 AT4G14660 263 / 5e-91 RNA polymerase Rpb7-like, N-terminal domain (.1)
Lus10035380
[exp]
54 / 4e-09 AT1G06790 235 / 3e-79 RNA polymerase Rpb7 N-terminal domain-containing protein (.1.2)
Lus10024251
[exp]
40 / 0.0001 AT4G14660 117 / 1e-34 RNA polymerase Rpb7-like, N-terminal domain (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0021 OB PF00575 S1 S1 RNA binding domain
CL0319 SHS2 PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Representative CDS sequence
>Potri.001G377200.1 pacid=42790947 polypeptide=Potri.001G377200.1.p locus=Potri.001G377200 ID=Potri.001G377200.1.v4.1 annot-version=v4.1
ATGTTTTTCCACATAGTGTTGGAGAGGAACATGCAATTGCACCCTCGCTTCTTTGGGCGCAACCTCCGCGAGAATATTGTCTCCAAGCTCATGAAAGATG
TCGAGGGCACTTGCAGTGGTCGACATGGATTTGTGGTGGCAATAACAGGCATTGAAAACATCGGGAAAGGATTGATCCGAGATGGGACTGGATTCGTGAC
GTTTCCAGTCAAGTACCAATGTGTCGTGTTTAGGCCATTTAAGGGAGAAATTCTAGAAGCTGTTGTTACCATGGTAAATAAGATGGGATTTTTTGCTGAA
GCGGGGCCAGTTCAAATCTTTGTTTCAAACCATTTGATACCGGATGATATGGAGTTCCAGACTGGAGATATGCCAAACTATACAACTTCAGATGGATCGG
TTAAGATTCAAAAGGATAGTGAAGTGCGATTGAAGATCATCGGAACGCGTGTTGATGCCACAGAAATTTTCTGCATTGGCACCATAAAGGATGATTTCTT
GGGAGTTATAAATGATCCTGCAAATGCTTAG
AA sequence
>Potri.001G377200.1 pacid=42790947 polypeptide=Potri.001G377200.1.p locus=Potri.001G377200 ID=Potri.001G377200.1.v4.1 annot-version=v4.1
MFFHIVLERNMQLHPRFFGRNLRENIVSKLMKDVEGTCSGRHGFVVAITGIENIGKGLIRDGTGFVTFPVKYQCVVFRPFKGEILEAVVTMVNKMGFFAE
AGPVQIFVSNHLIPDDMEFQTGDMPNYTTSDGSVKIQKDSEVRLKIIGTRVDATEIFCIGTIKDDFLGVINDPANA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G59180 NRPB7 DNA-directed RNA polymerase II... Potri.001G377200
[exp]
0 1 RPB19.1
AT4G21110 G10 family protein (.1) Potri.009G147000
[exp]
1.00 0.9320
AT2G30000 PHF5-like protein (.1) Potri.001G277700
[exp]
1.41 0.8783
AT5G46030 unknown protein Potri.011G097300
[exp]
3.87 0.8677
AT1G71750 HGPT Hypoxanthine-guanine phosphori... Potri.005G198400
[exp]
6.32 0.8464
AT5G12240 unknown protein Potri.009G069000
[exp]
7.74 0.8602
AT4G32605 Mitochondrial glycoprotein fam... Potri.010G244500
[exp]
7.74 0.8106
AT2G24860 DnaJ/Hsp40 cysteine-rich domai... Potri.018G016400
[exp]
10.67 0.8025
AT1G03430 AHP5 histidine-containing phosphotr... Potri.006G098200
[exp]
11.22 0.8422 Pt-HPT3.2
AT3G15351 unknown protein Potri.002G142000
[exp]
11.74 0.8439
AT4G26980 RNI-like superfamily protein (... Potri.011G090700
[exp]
13.56 0.8398

Potri.001G377200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.