Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G53530 227 / 4e-77 Peptidase S24/S26A/S26B/S26C family protein (.1.2) AT1G29960 166 / 3e-53 AGL64 Peptidase S24/S26A/S26B/S26C family protein (.1) AT1G23465 160 / 5e-51 Peptidase S24/S26A/S26B/S26C family protein (.1) AT3G08980 86 / 8e-22 Peptidase S24/S26A/S26B/S26C family protein (.1) AT1G06870 72 / 4e-15 Plsp2A plastidic type I signal peptidase 2A, Peptidase S24/S26A/S26B/S26C family protein (.1) AT2G30440 71 / 9e-15 Plsp2B, TPP plastidic type I signal peptidase 2B, thylakoid processing peptide (.1) AT3G24590 66 / 3e-13 PLSP1 plastidic type i signal peptidase 1 (.1) AT2G31140 45 / 3e-06 Peptidase S24/S26A/S26B/S26C family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G071400 [exp] 203 / 7e-68 AT1G53530 194 / 7e-64 Peptidase S24/S26A/S26B/S26C family protein (.1.2) Potri.005G092900 [exp] 194 / 5e-64 AT1G53530 189 / 5e-62 Peptidase S24/S26A/S26B/S26C family protein (.1.2) Potri.016G115100 [exp] 84 / 5e-21 AT3G08980 204 / 3e-68 Peptidase S24/S26A/S26B/S26C family protein (.1) Potri.014G036400 [exp] 73 / 2e-15 AT1G06870 377 / 8e-130 plastidic type I signal peptidase 2A, Peptidase S24/S26A/S26B/S26C family protein (.1) Potri.006G157900 [exp] 66 / 4e-13 AT3G24590 357 / 5e-124 plastidic type i signal peptidase 1 (.1) Potri.018G081800 [exp] 65 / 6e-13 AT3G24590 372 / 3e-130 plastidic type i signal peptidase 1 (.1) Potri.002G079600 [exp] 50 / 6e-08 AT3G24590 177 / 3e-55 plastidic type i signal peptidase 1 (.1) Potri.005G225100 [exp] 46 / 2e-06 AT2G31140 274 / 2e-94 Peptidase S24/S26A/S26B/S26C family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005571 [exp] 214 / 5e-72 AT1G53530 213 / 1e-71 Peptidase S24/S26A/S26B/S26C family protein (.1.2) Lus10013703 [exp] 215 / 6e-67 AT1G78510 542 / 0.0 solanesyl diphosphate synthase 1 (.1.2) Lus10025393 [exp] 177 / 1e-57 AT1G53530 169 / 3e-54 Peptidase S24/S26A/S26B/S26C family protein (.1.2) Lus10015272 [exp] 118 / 6e-34 AT1G53530 111 / 4e-31 Peptidase S24/S26A/S26B/S26C family protein (.1.2) Lus10033448 [exp] 113 / 6e-33 AT1G53530 110 / 1e-32 Peptidase S24/S26A/S26B/S26C family protein (.1.2) Lus10002492 [exp] 99 / 2e-26 AT3G08980 191 / 5e-63 Peptidase S24/S26A/S26B/S26C family protein (.1) Lus10015755 [exp] 95 / 3e-25 AT1G53530 86 / 4e-22 Peptidase S24/S26A/S26B/S26C family protein (.1.2) Lus10004822 [exp] 94 / 9e-25 AT3G08980 190 / 9e-63 Peptidase S24/S26A/S26B/S26C family protein (.1) Lus10036985 [exp] 71 / 2e-14 AT2G44220 218 / 7e-65 Protein of Unknown Function (DUF239) (.1) Lus10032753 [exp] 67 / 2e-13 AT1G06870 379 / 3e-125 plastidic type I signal peptidase 2A, Peptidase S24/S26A/S26B/S26C family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0299 [poplar] [flax] Peptidase_SF PF00717 [poplar] [flax] Peptidase_S24 Peptidase S24-like
Representative CDS sequence Show only first row Show all	>Potri.001G380400.15 pacid=42790184 polypeptide=Potri.001G380400.15.p locus=Potri.001G380400 ID=Potri.001G380400.15.v4.1 annot-version=v4.1 ATGAATGCATGGAAAAGCATAGCCAAAGAAGCATTCTCCCAAACTTGTCTTGTCGCCAAGTTCCTTGGCTTCCTTCACCTCACCAACAACTACCTCATCT CTCCCACTCTCGTTTACGGCCCTAGCATGCTCCCAACGCTAAATCTAACGGGCGACGTCTTATTAGTGGAGCACGTGTCTCACCGCTTCCAGAAGGTGGG TCCAGGAGATGTGGTACTGGTTCGGTCACCTTTAGATCCTACAAAGATGGTCACTAAACGCATTGTTGGTATGGAGGGTGATCAAATCAATTTCTTGCCC GATCCCTCCATAACTGACATCTGTCGCACCATCATGGTACCGAAGGGGCACATTTGGATTCAGGGCGATAACATGTATGCTTCCTGTGATTCACGGCATT ATGGGCCTGTTCCATATGGTCTTGTTCAAGGCAAGCTCTTTTTCAGGGTATGGCCACCTTCTAGCTTTGGATCTTTCGGTCAGTGA
AA sequence Show only first row Show all	>Potri.001G380400.15 pacid=42790184 polypeptide=Potri.001G380400.15.p locus=Potri.001G380400 ID=Potri.001G380400.15.v4.1 annot-version=v4.1 MNAWKSIAKEAFSQTCLVAKFLGFLHLTNNYLISPTLVYGPSMLPTLNLTGDVLLVEHVSHRFQKVGPGDVVLVRSPLDPTKMVTKRIVGMEGDQINFLP DPSITDICRTIMVPKGHIWIQGDNMYASCDSRHYGPVPYGLVQGKLFFRVWPPSSFGSFGQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G53530			Peptidase S24/S26A/S26B/S26C f...		Potri.001G380400 [exp]	0	1
AT2G37500			arginine biosynthesis protein ...		Potri.015G112400 [exp]	3.16	0.7262
					Potri.001G407401 [exp]	4.89	0.7745
AT1G31660			unknown protein		Potri.001G394000 [exp]	21.63	0.7093
AT5G66430			S-adenosyl-L-methionine-depend...		Potri.014G168166 [exp]	29.32	0.7055
AT3G48730		GSA2	glutamate-1-semialdehyde 2,1-a...		Potri.012G103000 [exp]	31.89	0.6031
AT5G58700		ATPLC4	phosphatidylinositol-speciwc p...		Potri.001G252100 [exp]	35.49	0.6545
					Potri.008G141600 [exp]	36.52	0.6455
AT4G25440	C3HZnF	ZFWD1	zinc finger WD40 repeat protei...		Potri.015G137200 [exp]	39.59	0.6361
AT1G04230			Protein of unknown function (D...		Potri.008G160800 [exp]	58.45	0.6387
AT5G22040			unknown protein		Potri.008G015500 [exp]	58.80	0.6845

Compare expression of checked genes

Potri.001G380400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.