Potri.001G380600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G78520 145 / 3e-46 Carbohydrate-binding X8 domain superfamily protein (.1)
AT2G43670 120 / 2e-36 Carbohydrate-binding X8 domain superfamily protein (.1)
AT3G28250 103 / 7e-30 Carbohydrate-binding X8 domain superfamily protein (.1)
AT4G09462 96 / 7e-27 Carbohydrate-binding X8 domain superfamily protein (.1)
AT4G09467 94 / 4e-26 Carbohydrate-binding X8 domain superfamily protein (.1)
AT4G09464 94 / 4e-26 Carbohydrate-binding X8 domain superfamily protein (.1)
AT4G09465 94 / 5e-26 Carbohydrate-binding X8 domain superfamily protein (.1)
AT2G43660 92 / 2e-25 Carbohydrate-binding X8 domain superfamily protein (.1.2)
AT5G53600 91 / 4e-25 Carbohydrate-binding X8 domain superfamily protein (.1)
AT4G09090 90 / 2e-24 Carbohydrate-binding X8 domain superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G101451 171 / 5e-57 AT1G78520 124 / 2e-38 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.011G099000 171 / 8e-57 AT1G78520 133 / 4e-42 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.011G099600 158 / 2e-51 AT1G78520 127 / 6e-39 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.011G101351 156 / 8e-51 AT1G78520 126 / 1e-38 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.001G351600 124 / 8e-38 AT1G78520 119 / 9e-36 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.014G114500 95 / 3e-26 AT1G66870 96 / 1e-26 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.002G007300 95 / 5e-24 AT4G29360 339 / 1e-111 O-Glycosyl hydrolases family 17 protein (.1.2)
Potri.001G240000 94 / 1e-23 AT5G24318 508 / 2e-178 O-Glycosyl hydrolases family 17 protein (.1.2)
Potri.008G056000 89 / 6e-22 AT3G55430 494 / 1e-173 O-Glycosyl hydrolases family 17 protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042492 147 / 6e-47 AT1G78520 127 / 3e-39 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10026175 132 / 6e-40 AT1G78520 114 / 2e-32 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10016539 94 / 2e-23 AT5G24318 484 / 1e-168 O-Glycosyl hydrolases family 17 protein (.1.2)
Lus10040808 90 / 3e-22 AT5G24318 484 / 2e-168 O-Glycosyl hydrolases family 17 protein (.1.2)
Lus10040461 85 / 2e-20 AT2G16230 649 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Lus10004962 83 / 2e-19 AT5G24318 462 / 8e-161 O-Glycosyl hydrolases family 17 protein (.1.2)
Lus10023576 82 / 2e-19 AT2G16230 644 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Lus10034607 82 / 3e-19 AT2G01630 691 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2)
Lus10005459 81 / 3e-19 AT5G24318 341 / 3e-115 O-Glycosyl hydrolases family 17 protein (.1.2)
Lus10040294 81 / 4e-19 AT3G55430 483 / 2e-169 O-Glycosyl hydrolases family 17 protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07983 X8 X8 domain
Representative CDS sequence
>Potri.001G380600.2 pacid=42788065 polypeptide=Potri.001G380600.2.p locus=Potri.001G380600 ID=Potri.001G380600.2.v4.1 annot-version=v4.1
ATGGCTAAAGCAATGGCAGCTCTCTCTCTTTTGCTCCTACTACTTTACCTCAGTTCAGGGGGGGGTTCGGTCATGGCTAATGAACAGAAAACTTGGTGTG
TGGCCAAGCCATCGTCAGACCAAGCAACTTTACTAGCGAATATCAATTACGCATGCGCTCACGTGGATTGCCAGATTCTACAAAAGGGTTGCCCTTGCTT
CTCTCCAGATAGTCTCATAAACCATGCATCCATAGCTATGAATCTGTATTACCAATGTAAGGGAAGGAACCACTGGAATTGCGATTTCAGGAACTCTGGC
CTCATTGTCGTGACTGATCCAAGTTATAGTAACTGCATCTATGCCTAA
AA sequence
>Potri.001G380600.2 pacid=42788065 polypeptide=Potri.001G380600.2.p locus=Potri.001G380600 ID=Potri.001G380600.2.v4.1 annot-version=v4.1
MAKAMAALSLLLLLLYLSSGGGSVMANEQKTWCVAKPSSDQATLLANINYACAHVDCQILQKGCPCFSPDSLINHASIAMNLYYQCKGRNHWNCDFRNSG
LIVVTDPSYSNCIYA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G78520 Carbohydrate-binding X8 domain... Potri.001G380600 0 1
AT1G32930 Galactosyltransferase family p... Potri.001G450200 8.48 0.8645
AT4G38190 ATCSLD4 ARABIDOPSIS THALIANA CELLULOSE... Potri.009G170000 9.48 0.8354 ATCSLD4.1
AT1G09300 Metallopeptidase M24 family pr... Potri.013G007100 11.09 0.7212
AT2G05990 ENR1, MOD1 MOSAIC DEATH 1, ENOYL-ACP REDU... Potri.003G212700 12.96 0.8242 Pt-MOD1.2
AT2G20080 unknown protein Potri.006G161100 21.81 0.8091
AT2G13570 CCAAT NF-YB7 "nuclear factor Y, subunit B7"... Potri.007G103901 21.81 0.8184
AT4G32150 ATVAMP711, VAMP... vesicle-associated membrane pr... Potri.018G025800 24.69 0.8115 VAMP712.1
AT4G01240 S-adenosyl-L-methionine-depend... Potri.004G116900 30.88 0.8017
AT3G47890 Ubiquitin carboxyl-terminal hy... Potri.017G089250 33.24 0.7819
Potri.012G080700 35.66 0.8049

Potri.001G380600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.