Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-SRG1.3
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17020 436 / 2e-153 ATSRG1, SRG1 senescence-related gene 1 (.1) AT1G17010 429 / 1e-150 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G25300 412 / 5e-144 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G78550 401 / 6e-140 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G25310 401 / 7e-140 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G21420 259 / 4e-84 LBO1 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G38240 245 / 1e-78 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G05600 236 / 9e-75 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G55970 226 / 3e-71 ATJRG21 jasmonate-regulated gene 21 (.1) AT3G11180 225 / 2e-70 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G382400 [exp] 514 / 0 AT1G17020 446 / 1e-157 senescence-related gene 1 (.1) Potri.001G355100 [exp] 454 / 1e-160 AT1G17020 439 / 1e-154 senescence-related gene 1 (.1) Potri.009G025900 [exp] 413 / 2e-144 AT4G25300 410 / 3e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.001G355200 [exp] 329 / 2e-111 AT1G17020 329 / 3e-111 senescence-related gene 1 (.1) Potri.009G022800 [exp] 298 / 3e-99 AT1G17020 302 / 6e-101 senescence-related gene 1 (.1) Potri.010G023600 [exp] 276 / 8e-91 AT3G21420 511 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G201000 [exp] 269 / 7e-88 AT3G21420 290 / 5e-96 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G200900 [exp] 249 / 3e-80 AT3G21420 288 / 4e-95 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.006G101200 [exp] 244 / 5e-78 AT5G05600 474 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022292 [exp] 481 / 2e-171 AT1G17020 449 / 5e-159 senescence-related gene 1 (.1) Lus10032574 [exp] 451 / 3e-159 AT4G25300 419 / 2e-146 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10026173 [exp] 430 / 6e-151 AT1G17020 443 / 5e-156 senescence-related gene 1 (.1) Lus10011981 [exp] 399 / 7e-139 AT1G17020 375 / 2e-129 senescence-related gene 1 (.1) Lus10011980 [exp] 399 / 9e-139 AT1G17020 382 / 1e-132 senescence-related gene 1 (.1) Lus10011979 [exp] 383 / 1e-132 AT1G17020 374 / 4e-129 senescence-related gene 1 (.1) Lus10011985 [exp] 383 / 2e-132 AT1G17020 367 / 4e-126 senescence-related gene 1 (.1) Lus10015252 [exp] 379 / 6e-131 AT1G17020 375 / 1e-129 senescence-related gene 1 (.1) Lus10030995 [exp] 326 / 3e-110 AT1G17020 339 / 2e-115 senescence-related gene 1 (.1) Lus10030934 [exp] 315 / 1e-105 AT1G17020 337 / 2e-114 senescence-related gene 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.001G381700.1 pacid=42788074 polypeptide=Potri.001G381700.1.p locus=Potri.001G381700 ID=Potri.001G381700.1.v4.1 annot-version=v4.1 ATGGCATCCAAACCATCAAGTCTTGGAAGCTCCCTGCTTGTGCCCTGTGTTCAAGAATTGGCCAAGGATCTTTTGGTCGCTGTTCCACCAAGATACATCC GTTATGACCAAGAACATCCCATCATTGCTAGTCATGATCCGGTATCTGAGGTTCCAGTTATTGATATGCAGAGATTACTTGATCAAGAAACGATGGATTC TGAATTGGGCCGCCTCCATTTCGCTTGCAAAACATGGGGTTTCTTCCAGTTGGTAAACCATTGTGTAAGCTCTTCGTTGTTAGACAAAATGAAGACACAA CTTCAGGATTTCTTCAACCTCCCAATGGAGGAAAAGAAAAGGTTCTGGCAGTATCCAGGAGAAATAGAGGGTTTTGGACAAGCTTTTGTTGTATCTGAGG AGCAAAAGCTTGATTGGGGCGATCTGTTCTTCATGGTCACCCAGCCAGCTAATTTAAGAAAGCCTCACCTATTCCCAAAACTCCCTCTTCCTTTCAGAGA CACCTTGGAGAGCTACTCCTTGGAAGTGAAAAATCTAGCGTCTGCTATTCTTGAACAGATGGGAAAAGCTTTAAACATTAAAGCTGAAGAAATGAGAGAT TTCACAGAGGGCATAAGACAATCAATGAGGATGAACTATTATCCGCAGTGTCCTCAACCAGAGCAAGTTATTGGCCTTACACCTCATTCTGATGCCACCG GTCTCACAATTCTCCTACAAGTTAATGAAGTGGAAGGTCTGCAGTTAAGGAAGGATGGGAAGTGGGTTCCCATAAAGCCACTGCCAAATGCTTTTGTTGT CAATGTTGGAGACATTTTGGAGATTGTAACCAATGGTGCATATCGTAGCATCGAGCATCGTGCAACAGTAAACTCTAAGAAGGAAAGACTTTCAGTTGCT TCATTCCATTCCCCGAGGTTTGATGGCAAAGTATGCCCAGCTCCTAGCTTGGTAACCGAACAAACACCAGCATTGTTTAAAGAAGTTCCAGTTAAAGAGT ACTTCAAGGGCCTGTTTTCTCGTGAGCTTGTTGGAAAATCTTATCTTGATACATTGAGAATACAAGATGGTCAAGCCTAA
AA sequence Show only first row Show all	>Potri.001G381700.1 pacid=42788074 polypeptide=Potri.001G381700.1.p locus=Potri.001G381700 ID=Potri.001G381700.1.v4.1 annot-version=v4.1 MASKPSSLGSSLLVPCVQELAKDLLVAVPPRYIRYDQEHPIIASHDPVSEVPVIDMQRLLDQETMDSELGRLHFACKTWGFFQLVNHCVSSSLLDKMKTQ LQDFFNLPMEEKKRFWQYPGEIEGFGQAFVVSEEQKLDWGDLFFMVTQPANLRKPHLFPKLPLPFRDTLESYSLEVKNLASAILEQMGKALNIKAEEMRD FTEGIRQSMRMNYYPQCPQPEQVIGLTPHSDATGLTILLQVNEVEGLQLRKDGKWVPIKPLPNAFVVNVGDILEIVTNGAYRSIEHRATVNSKKERLSVA SFHSPRFDGKVCPAPSLVTEQTPALFKEVPVKEYFKGLFSRELVGKSYLDTLRIQDGQA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G17020		ATSRG1, SRG1	senescence-related gene 1 (.1)		Potri.001G381700 [exp]	0	1	Pt-SRG1.3
AT4G14090			UDP-Glycosyltransferase superf...		Potri.017G101800 [exp]	1.73	0.9193
AT4G10170			SNARE-like superfamily protein...		Potri.013G094900 [exp]	2.44	0.8965
AT5G45110		ATNPR3, NPR3	NPR1-like protein 3 (.1)		Potri.002G056500 [exp]	3.87	0.9141
AT3G17700		ATCNGC20, CNBT1	CYCLIC NUCLEOTIDE-GATED CHANNE...		Potri.012G038700 [exp]	4.89	0.9082	Pt-ATCNGC19.3
AT5G14170		CHC1	SWIB/MDM2 domain superfamily p...		Potri.012G096700 [exp]	5.19	0.8913
AT2G02370			SNARE associated Golgi protein...		Potri.001G078700 [exp]	7.48	0.8837
AT3G26020			Protein phosphatase 2A regulat...		Potri.008G179900 [exp]	7.61	0.8724
AT1G76680		OPR1, ATOPR1	ARABIDOPSIS 12-OXOPHYTODIENOAT...		Potri.003G004200 [exp]	9.21	0.8798
AT1G64950		CYP89A5	"cytochrome P450, family 89, s...		Potri.007G087950 [exp]	9.53	0.8837
					Potri.009G149000 [exp]	9.79	0.8800

Compare expression of checked genes

Potri.001G381700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.