Plant FIBer expression Database

Potri.001G392400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G29140 137 / 1e-41 Pollen Ole e 1 allergen and extensin family protein (.1)
AT4G18596 125 / 6e-37 Pollen Ole e 1 allergen and extensin family protein (.1)
AT5G45880 116 / 2e-33 Pollen Ole e 1 allergen and extensin family protein (.1)
AT4G08685 99 / 8e-27 SAH7 Pollen Ole e 1 allergen and extensin family protein (.1)
AT5G10130 89 / 6e-23 Pollen Ole e 1 allergen and extensin family protein (.1)
AT1G78040 85 / 3e-21 Pollen Ole e 1 allergen and extensin family protein (.1.2)
AT5G05500 46 / 2e-06 MOP10 Pollen Ole e 1 allergen and extensin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G111300
[exp]
280 / 3e-98 AT1G29140 148 / 4e-46 Pollen Ole e 1 allergen and extensin family protein (.1)
Potri.007G090100
[exp]
115 / 2e-33 AT4G08685 152 / 1e-47 Pollen Ole e 1 allergen and extensin family protein (.1)
Potri.005G078200
[exp]
112 / 5e-32 AT4G08685 165 / 5e-53 Pollen Ole e 1 allergen and extensin family protein (.1)
Potri.005G167900
[exp]
111 / 8e-32 AT4G08685 171 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1)
Potri.002G093100
[exp]
109 / 6e-31 AT4G08685 199 / 3e-66 Pollen Ole e 1 allergen and extensin family protein (.1)
Potri.010G185400
[exp]
43 / 1e-05 AT5G05500 166 / 8e-53 Pollen Ole e 1 allergen and extensin family protein (.1)
Potri.001G326200
[exp]
42 / 3e-05 AT5G41050 158 / 9e-50 Pollen Ole e 1 allergen and extensin family protein (.1)
Potri.001G060500
[exp]
42 / 4e-05 AT5G13140 185 / 3e-57 Pollen Ole e 1 allergen and extensin family protein (.1)
Potri.017G068400
[exp]
42 / 5e-05 AT5G41050 172 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028134
[exp]
163 / 6e-52 AT1G29140 118 / 4e-34 Pollen Ole e 1 allergen and extensin family protein (.1)
Lus10018131
[exp]
161 / 4e-51 AT1G29140 118 / 5e-34 Pollen Ole e 1 allergen and extensin family protein (.1)
Lus10042838
[exp]
158 / 6e-50 AT1G29140 115 / 6e-33 Pollen Ole e 1 allergen and extensin family protein (.1)
Lus10017940
[exp]
156 / 4e-49 AT1G29140 117 / 8e-34 Pollen Ole e 1 allergen and extensin family protein (.1)
Lus10013681
[exp]
155 / 1e-48 AT1G29140 117 / 6e-34 Pollen Ole e 1 allergen and extensin family protein (.1)
Lus10001895
[exp]
139 / 2e-42 AT1G29140 157 / 2e-49 Pollen Ole e 1 allergen and extensin family protein (.1)
Lus10013908
[exp]
138 / 2e-39 AT2G42590 400 / 1e-139 general regulatory factor 9 (.1.2.3)
Lus10042201
[exp]
106 / 1e-29 AT4G08685 171 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1)
Lus10008615
[exp]
103 / 2e-28 AT4G08685 166 / 3e-53 Pollen Ole e 1 allergen and extensin family protein (.1)
Lus10026040
[exp]
98 / 3e-26 AT5G10130 159 / 3e-50 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0287 Transthyretin PF01190 Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence
>Potri.001G392400.1 pacid=42791656 polypeptide=Potri.001G392400.1.p locus=Potri.001G392400 ID=Potri.001G392400.1.v4.1 annot-version=v4.1
ATGGCAAAGAGTTTCACCATTGCTGCCTTCGTTCTTTGCTTCTCCTCCCTTCTCATCTCTGCCTATGCAGCAGATTACTTGGATGTTGAAGGCAAGGTCT
ACTGTGACCCTTGCCGCGTTGAGTTCCAGACCAAAATCAGCGAGGGAATACCAGCTGCTAAGGTGAAATTGGTATGTAACAACCGTGATAATGGCACTGA
GACATATACCGTGGAGGGTGCAACTGACAACAGCGGCACATACCGCCTCCCCGTGGCGGGAGACCATGAGGATGATATCTGTGAGGTCAGGTTGGTGGAG
AGCTCCAGACCCGATTGCAATGAACCATTCCGGAGCATTGATTCTGCCAGGATCCTCCTCACCAAGAACGTTGGAGTGGTGGATAAAACTCGATATCCCA
ATGCTCTTGGGTACATGAAGAAGGAGGCTCAACCAGAATGTGCAGATGTGCTCAAAGAAATGGGTTTCCTTCCTCTTGAGGTTTAA
AA sequence
>Potri.001G392400.1 pacid=42791656 polypeptide=Potri.001G392400.1.p locus=Potri.001G392400 ID=Potri.001G392400.1.v4.1 annot-version=v4.1
MAKSFTIAAFVLCFSSLLISAYAADYLDVEGKVYCDPCRVEFQTKISEGIPAAKVKLVCNNRDNGTETYTVEGATDNSGTYRLPVAGDHEDDICEVRLVE
SSRPDCNEPFRSIDSARILLTKNVGVVDKTRYPNALGYMKKEAQPECADVLKEMGFLPLEV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Download tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G29140 Pollen Ole e 1 allergen and ex... Potri.001G392400
[exp]
0 1

Potri.001G392400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.