Plant FIBer expression Database

Potri.001G393101 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G29290 45 / 1e-07 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G108101
[exp]
111 / 7e-34 AT1G29290 44 / 4e-07 unknown protein
Potri.004G061300
[exp]
48 / 2e-08 AT1G29290 71 / 3e-17 unknown protein
Potri.011G070500
[exp]
41 / 5e-06 AT1G29290 42 / 7e-06 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029256
[exp]
44 / 7e-07 AT1G29290 64 / 2e-14 unknown protein
Lus10007309
[exp]
38 / 8e-05 AT1G29290 62 / 8e-14 unknown protein
PFAM info
Representative CDS sequence
>Potri.001G393101.1 pacid=42789180 polypeptide=Potri.001G393101.1.p locus=Potri.001G393101 ID=Potri.001G393101.1.v4.1 annot-version=v4.1
ATGGCTCGTTTAAGCACAGTCCCGTTCATCTTCTTTCTCATTTTGATTTGTCACGCACAGTCTTTTGAAGCCAGAAAGTTCTTGAGCTTGGAGAAGAACG
AAAACCCTTCTTTGAAAGACAATACTACGCCATCTTACTATCGTGTTAGTGAAGGCCATGCAATAGTTATCGATACAGGGTTCATCATTTCCCACCTTTC
CAAGATCGATCGAATTTTGCGTTCCGCCCCCAGTCCTGGAACAGGAAACTAG
AA sequence
>Potri.001G393101.1 pacid=42789180 polypeptide=Potri.001G393101.1.p locus=Potri.001G393101 ID=Potri.001G393101.1.v4.1 annot-version=v4.1
MARLSTVPFIFFLILICHAQSFEARKFLSLEKNENPSLKDNTTPSYYRVSEGHAIVIDTGFIISHLSKIDRILRSAPSPGTGN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G29290 unknown protein Potri.001G393101
[exp]
0 1
AT3G53310 B3 REM20 AP2/B3-like transcriptional fa... Potri.004G219900
[exp]
2.82 0.9844
Potri.004G221450
[exp]
9.89 0.9852
AT3G04720 HEL, PR-4, PR4 HEVEIN-LIKE, pathogenesis-rela... Potri.013G041900
[exp]
20.71 0.9817
AT3G42880 Leucine-rich repeat protein ki... Potri.006G139700
[exp]
22.58 0.9709
AT1G29670 GDSL-like Lipase/Acylhydrolase... Potri.003G213700
[exp]
23.83 0.9812
Potri.003G010433
[exp]
29.08 0.9811
Potri.018G082700
[exp]
31.41 0.9811
AT5G06860 ATPGIP1, PGIP1 polygalacturonase inhibiting p... Potri.006G058600
[exp]
31.60 0.9697 Pt-PGIP.4
Potri.003G010730
[exp]
33.46 0.9808
Potri.003G010499
[exp]
35.87 0.9808

Potri.001G393101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.