Potri.001G396100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G23750 194 / 6e-65 Nucleic acid-binding, OB-fold-like protein (.1)
AT2G33845 196 / 8e-65 Nucleic acid-binding, OB-fold-like protein (.1)
AT4G28440 184 / 1e-60 Nucleic acid-binding, OB-fold-like protein (.1)
AT1G10590 179 / 1e-58 Nucleic acid-binding, OB-fold-like protein (.1.2.3)
AT1G03810 169 / 6e-55 Nucleic acid-binding, OB-fold-like protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G114800 236 / 2e-81 AT2G33845 214 / 3e-72 Nucleic acid-binding, OB-fold-like protein (.1)
Potri.010G041000 217 / 8e-74 AT1G23750 234 / 1e-80 Nucleic acid-binding, OB-fold-like protein (.1)
Potri.008G189900 212 / 8e-72 AT1G23750 239 / 9e-83 Nucleic acid-binding, OB-fold-like protein (.1)
Potri.007G137600 191 / 1e-63 AT4G28440 193 / 2e-64 Nucleic acid-binding, OB-fold-like protein (.1)
Potri.017G014400 187 / 8e-62 AT4G28440 194 / 9e-65 Nucleic acid-binding, OB-fold-like protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030617 205 / 6e-69 AT1G23750 229 / 7e-79 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10030871 203 / 2e-68 AT1G23750 226 / 2e-77 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10015411 192 / 1e-63 AT2G33845 186 / 4e-61 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10013989 189 / 2e-62 AT4G28440 186 / 3e-61 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10029155 186 / 2e-61 AT1G23750 206 / 1e-69 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10002172 184 / 6e-61 AT2G33845 189 / 1e-62 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10013010 182 / 8e-60 AT1G23750 206 / 1e-69 Nucleic acid-binding, OB-fold-like protein (.1)
Lus10039889 179 / 8e-59 AT2G33845 185 / 1e-60 Nucleic acid-binding, OB-fold-like protein (.1)
PFAM info
Representative CDS sequence
>Potri.001G396100.2 pacid=42788486 polypeptide=Potri.001G396100.2.p locus=Potri.001G396100 ID=Potri.001G396100.2.v4.1 annot-version=v4.1
ATGGCAACACCAACAAAAACAGGAAAGGAACAACAAGAAGAGAGCAGCAATGCGGGTGGGAAACCTGGACTTAGAAAGCCTGTCTTCACCAAAGTGGACC
TGCTTAAGCCTGGAACTGGAGGTCATACCTTGACTGTCAAGGTCCTTAATTCCATTGCTGTCCTTCCAAAGGGCCGATCGGTCTCTCACCATCTCCGTCA
GTCACGAATCGCTGAATGTCTTATTGGGGATGACACTGGTTCCATCATCTTCACCGCAAGAAACGAACAAGTTGATTTGGTGAAGCCAGGGACGACTGTA
ATCCTCCGCAATGCAAAGATTGACATGTTTAAGGGATCTATGAGGCTAGCAGTTGACAAATGGGGTCGTGTTGAAGTCACTGAGCCTGCAGAATTTGTAG
TCAAGGAAGACAACAATCTCTCTCTTGTTGAATACGAGCTTGTGAATGTTACAGGAGAGTGA
AA sequence
>Potri.001G396100.2 pacid=42788486 polypeptide=Potri.001G396100.2.p locus=Potri.001G396100 ID=Potri.001G396100.2.v4.1 annot-version=v4.1
MATPTKTGKEQQEESSNAGGKPGLRKPVFTKVDLLKPGTGGHTLTVKVLNSIAVLPKGRSVSHHLRQSRIAECLIGDDTGSIIFTARNEQVDLVKPGTTV
ILRNAKIDMFKGSMRLAVDKWGRVEVTEPAEFVVKEDNNLSLVEYELVNVTGE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G23750 Nucleic acid-binding, OB-fold-... Potri.001G396100 0 1
AT3G62290 ATARFA1E ADP-ribosylation factor A1E (.... Potri.001G301200 4.69 0.9560
AT2G04520 Nucleic acid-binding, OB-fold-... Potri.002G031700 10.34 0.8861
AT4G05050 UBQ11 ubiquitin 11 (.1.2.3.4) Potri.006G045300 10.39 0.9500
AT2G21080 unknown protein Potri.018G002700 14.96 0.9459
AT1G75250 MYB RSM3, ATRL6 RADIALIS-LIKE SANT/MYB 3, RAD-... Potri.002G035000 16.06 0.9452
AT3G48660 Protein of unknown function (D... Potri.001G058001 17.74 0.9447
AT3G07510 unknown protein Potri.014G176300 18.02 0.9308
AT3G14310 ATPME3 pectin methylesterase 3 (.1) Potri.006G256700 18.30 0.9454
AT5G53730 Late embryogenesis abundant (L... Potri.015G002400 20.71 0.8663
AT1G32250 Calcium-binding EF-hand family... Potri.014G030200 22.04 0.9405

Potri.001G396100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.