Potri.001G396600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G15190 147 / 9e-45 chloroplast 30S ribosomal protein S20, putative (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041925 164 / 3e-51 AT3G15190 160 / 1e-49 chloroplast 30S ribosomal protein S20, putative (.1)
Lus10005538 161 / 2e-50 AT3G15190 164 / 2e-51 chloroplast 30S ribosomal protein S20, putative (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01649 Ribosomal_S20p Ribosomal protein S20
Representative CDS sequence
>Potri.001G396600.3 pacid=42789425 polypeptide=Potri.001G396600.3.p locus=Potri.001G396600 ID=Potri.001G396600.3.v4.1 annot-version=v4.1
ATGGCGACTTCCCTTCTGTCTCCTTGCTTAGGCCTCCCTCCCAAACTCAAAAACCTCTCCCTTAATTCCACAACATGCTCTACGTCCACTTTCAGCTCCC
TCAGTTTCTCCTCTTCCCTCTCTCACAGTATCTTCAACAAAGGGTGTTTGTCAATGAGGACAACTCAAAGATCAATTCACAATTTCTCTATTGTCTGTGA
GTCGACTCCAAAGAAAAAGGCGGATTCAGCTGAAAAGAGAACTCGTCAAGCTGAGAAAAGAAGAGTTTATAATAAAGCTCGCAAGTCTGAAGTTAAAACC
CGCATGAAGAAGGTCTTGGAAGCACTGGATGATCTGAAAAAGAAACCTGAAGCACAATTTGAGGAGGTCCTTCCTATTGAAAAGCTAATAGCAGAGGCAT
ACTCGGTGATTGATAAAGCTATAAAAGTGGGAACCTTACATAGAAACACTGGCGCGCGCAGAAAGTCAAGGCTTGCCCGGAGAAAAAAGGCTGTGGAGAT
TCACCATGGCTGGTATAGTCCTGCTCCTGCAGCAGCAACTGCAAGTTAG
AA sequence
>Potri.001G396600.3 pacid=42789425 polypeptide=Potri.001G396600.3.p locus=Potri.001G396600 ID=Potri.001G396600.3.v4.1 annot-version=v4.1
MATSLLSPCLGLPPKLKNLSLNSTTCSTSTFSSLSFSSSLSHSIFNKGCLSMRTTQRSIHNFSIVCESTPKKKADSAEKRTRQAEKRRVYNKARKSEVKT
RMKKVLEALDDLKKKPEAQFEEVLPIEKLIAEAYSVIDKAIKVGTLHRNTGARRKSRLARRKKAVEIHHGWYSPAPAAATAS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G15190 chloroplast 30S ribosomal prot... Potri.001G396600 0 1
AT1G35680 RPL21C chloroplast ribosomal protein ... Potri.019G083400 1.41 0.9850 Pt-RPL21.3
AT1G68590 Ribosomal protein PSRP-3/Ycf65... Potri.008G118700 2.00 0.9863
AT1G64510 Translation elongation factor... Potri.001G088300 3.46 0.9846
AT5G28750 Bacterial sec-independent tran... Potri.013G040900 4.00 0.9739
AT3G12345 unknown protein Potri.008G047800 4.47 0.9842
AT3G01660 S-adenosyl-L-methionine-depend... Potri.001G340900 4.58 0.9812
AT3G54210 Ribosomal protein L17 family p... Potri.016G143100 5.47 0.9837
AT2G47450 CPSRP43, CAO CHLOROPLAST SIGNAL RECOGNITION... Potri.009G140500 6.00 0.9766 Pt-CAO.3
AT1G54500 Rubredoxin-like superfamily pr... Potri.013G035700 6.92 0.9806
AT5G52960 unknown protein Potri.012G033700 7.34 0.9778

Potri.001G396600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.