Potri.001G396700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G18790 58 / 6e-12 Ribosomal protein L33 family protein (.1)
AT3G06320 58 / 6e-12 Ribosomal protein L33 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G025900 57 / 7e-12 AT5G18790 107 / 4e-33 Ribosomal protein L33 family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012786 50 / 9e-09 AT5G18790 106 / 1e-32 Ribosomal protein L33 family protein (.1)
Lus10033990 50 / 2e-07 AT2G44710 301 / 2e-88 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0167 Zn_Beta_Ribbon PF00471 Ribosomal_L33 Ribosomal protein L33
Representative CDS sequence
>Potri.001G396700.1 pacid=42792441 polypeptide=Potri.001G396700.1.p locus=Potri.001G396700 ID=Potri.001G396700.1.v4.1 annot-version=v4.1
ATGATGGTGACAACTGCAATTCACTGCTTGACTCTTCCTTGCATGCCAAGGAATCCATCTCTCACCACCAACCTTTCTCTCTCTTCTCATCTAAAGCTTG
CAACTTCCAGGCCTCTCTCTAACCTCCTTTCTCATGGTCTCTTCTCCAAAGGTTTTCTGTCAATAAACACTATTGAGAGGTCAATTCGTCAGTCTGTTGT
TTGCATGGCTAGAAGATATGGTGCCAATACTAGGAAGAGAAAGATACAGAGCAGAAGAAAGGGTGGTGACCGAGAGAAGAAGAAGAAGCGTAGAAGGAAG
GCAGCCAGGAAGAATAAGGATAGCTTCAAAATCATCCGGCTTGTCTCAGCAGCAGGAACTGGATATGTCTATGCCAAGAGAAAAGGAAAGAGGAGTGAGA
AGCTTGAGATTAAGAAATATGACCCTGTTGTCAAGCATCATGTTTTCTTTAAAGAATCAAAATGA
AA sequence
>Potri.001G396700.1 pacid=42792441 polypeptide=Potri.001G396700.1.p locus=Potri.001G396700 ID=Potri.001G396700.1.v4.1 annot-version=v4.1
MMVTTAIHCLTLPCMPRNPSLTTNLSLSSHLKLATSRPLSNLLSHGLFSKGFLSINTIERSIRQSVVCMARRYGANTRKRKIQSRRKGGDREKKKKRRRK
AARKNKDSFKIIRLVSAAGTGYVYAKRKGKRSEKLEIKKYDPVVKHHVFFKESK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G18790 Ribosomal protein L33 family p... Potri.001G396700 0 1
AT5G22850 Eukaryotic aspartyl protease f... Potri.001G213600 2.82 0.7261
AT1G25500 Plasma-membrane choline transp... Potri.008G118200 3.31 0.7446
AT1G22340 ATUGT85A7 UDP-glucosyl transferase 85A7 ... Potri.016G022500 17.32 0.6569
AT2G42610 LSH10 LIGHT SENSITIVE HYPOCOTYLS 10,... Potri.011G109900 20.66 0.7033
AT5G45110 ATNPR3, NPR3 NPR1-like protein 3 (.1) Potri.015G116900 21.07 0.7072
AT5G13190 AtGILP GSH-induced LITAF domain prote... Potri.001G061900 22.71 0.7184
AT5G17680 disease resistance protein (TI... Potri.019G002500 24.37 0.6966
AT5G17640 Protein of unknown function (D... Potri.013G071000 25.03 0.6748
AT1G30760 FAD-binding Berberine family p... Potri.011G161300 27.92 0.6833
AT5G45110 ATNPR3, NPR3 NPR1-like protein 3 (.1) Potri.015G113466 29.15 0.7090

Potri.001G396700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.