Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G53130 149 / 2e-46 GRI GRIM REAPER, Stigma-specific Stig1 family protein (.1) AT5G55110 76 / 8e-18 Stigma-specific Stig1 family protein (.1) AT1G50720 73 / 5e-17 Stigma-specific Stig1 family protein (.1) AT4G26880 70 / 1e-15 Stigma-specific Stig1 family protein (.1) AT1G50650 67 / 2e-14 Stigma-specific Stig1 family protein (.1) AT1G11925 66 / 3e-14 Stigma-specific Stig1 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G118600 [exp] 229 / 2e-78 AT1G53130 136 / 1e-41 GRIM REAPER, Stigma-specific Stig1 family protein (.1) Potri.004G007100 [exp] 93 / 9e-25 AT1G11925 98 / 1e-26 Stigma-specific Stig1 family protein (.1) Potri.011G008932 [exp] 92 / 2e-24 AT1G11925 91 / 4e-24 Stigma-specific Stig1 family protein (.1) Potri.004G006900 [exp] 83 / 6e-21 AT1G11925 108 / 4e-31 Stigma-specific Stig1 family protein (.1) Potri.004G007000 [exp] 83 / 6e-21 AT1G11925 96 / 5e-26 Stigma-specific Stig1 family protein (.1) Potri.010G228100 [exp] 83 / 1e-20 AT1G11925 94 / 2e-25 Stigma-specific Stig1 family protein (.1) Potri.004G007200 [exp] 83 / 3e-20 AT1G11925 98 / 5e-26 Stigma-specific Stig1 family protein (.1) Potri.004G030900 [exp] 77 / 2e-18 AT1G11925 101 / 4e-28 Stigma-specific Stig1 family protein (.1) Potri.011G009000 [exp] 77 / 2e-18 AT1G11925 98 / 1e-26 Stigma-specific Stig1 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041930 [exp] 140 / 2e-43 AT1G53130 152 / 1e-47 GRIM REAPER, Stigma-specific Stig1 family protein (.1) Lus10005544 [exp] 119 / 2e-35 AT1G53130 125 / 6e-38 GRIM REAPER, Stigma-specific Stig1 family protein (.1) Lus10011146 [exp] 70 / 1e-15 AT1G50720 125 / 2e-37 Stigma-specific Stig1 family protein (.1) Lus10006512 [exp] 69 / 1e-15 AT1G50650 71 / 5e-16 Stigma-specific Stig1 family protein (.1) Lus10043047 [exp] 70 / 2e-15 AT1G50720 133 / 3e-40 Stigma-specific Stig1 family protein (.1) Lus10011117 [exp] 66 / 7e-14 AT1G50720 117 / 6e-34 Stigma-specific Stig1 family protein (.1) Lus10020831 [exp] 62 / 1e-12 AT1G11925 100 / 7e-28 Stigma-specific Stig1 family protein (.1) Lus10000696 [exp] 59 / 5e-11 AT1G50650 100 / 3e-26 Stigma-specific Stig1 family protein (.1) Lus10012679 [exp] 58 / 5e-11 AT1G11925 104 / 3e-29 Stigma-specific Stig1 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04885 [poplar] [flax] Stig1 Stigma-specific protein, Stig1
Representative CDS sequence Show only first row Show all	>Potri.001G399200.1 pacid=42789442 polypeptide=Potri.001G399200.1.p locus=Potri.001G399200 ID=Potri.001G399200.1.v4.1 annot-version=v4.1 ATGGCCAGTTCTTTACTCAAGCTTGCAGCCATTCTCTCCCTAGTCTTTTCCATCCTCCTAGCCTTGAACACTCAGATAACCTTATCATCCGATATAGAAG ACGATGACGAAGAGTATGTTCTTGACACCCCACTAGAAGGTTTCAGATCAAGAAGCCGTTTCTTGGCAAGTGTGATAAAGAAAGGTGCACGATGCAACGC TGAGCGTAATAACATATGTAATGGCGTTTCAGCTAACAAGGGCACGGGCCTACTTTATTGTTGCAAGAAACATTGCCGGAATGTTCTTGGAGACAAGAAC AACTGTGGAATGTGTGGTAACAAGTGCAAATTTGCGGAGTCTTGCTGCAATGGAAGATGTACAGATATCATTTCCAACGTTAATCATTGTGGAAAGTGCA ACAAGAAGTGTGCTCCGGGGGTTAGATGCCACTATGGAACATGTGGGTATGCTTAA
AA sequence Show only first row Show all	>Potri.001G399200.1 pacid=42789442 polypeptide=Potri.001G399200.1.p locus=Potri.001G399200 ID=Potri.001G399200.1.v4.1 annot-version=v4.1 MASSLLKLAAILSLVFSILLALNTQITLSSDIEDDDEEYVLDTPLEGFRSRSRFLASVIKKGARCNAERNNICNGVSANKGTGLLYCCKKHCRNVLGDKN NCGMCGNKCKFAESCCNGRCTDIISNVNHCGKCNKKCAPGVRCHYGTCGYA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G53130		GRI	GRIM REAPER, Stigma-specific S...		Potri.001G399200 [exp]	0	1
AT5G20260			Exostosin family protein (.1)		Potri.006G064600 [exp]	1.73	0.9683
AT4G05120		FUR1, ENT3, FLU...	FUDR RESISTANT 1, EQUILIBRATIV...		Potri.004G032400 [exp]	2.44	0.9620
AT4G37710			VQ motif-containing protein (....		Potri.007G006200 [exp]	5.74	0.9584
AT3G62760		ATGSTF13	Glutathione S-transferase fami...		Potri.014G132200 [exp]	6.32	0.9512	Pt-ATGSTF13.1
AT5G42650		CYP74A, AOS, DD...	DELAYED DEHISCENCE 2, CYTOCHRO...		Potri.004G149000 [exp]	9.79	0.9486	Pt-AOS.4,CYP74C7-1
AT3G53310	B3	REM20	AP2/B3-like transcriptional fa...		Potri.007G119400 [exp]	10.48	0.8803
AT5G39820	NAC	ANAC094	NAC domain containing protein ...		Potri.004G126901 [exp]	10.90	0.9392
AT4G15920		SWEET17, AtSWEE...	Nodulin MtN3 family protein (....		Potri.013G014500 [exp]	13.26	0.9249
AT2G43870			Pectin lyase-like superfamily ...		Potri.007G144100 [exp]	13.41	0.9305
AT5G60520			Late embryogenesis abundant (L...		Potri.009G012600 [exp]	13.85	0.9385

Compare expression of checked genes

Potri.001G399200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.