Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	ATCOX17.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G15352 102 / 4e-30 ATCOX17 ARABIDOPSIS THALIANA CYTOCHROME C OXIDASE 17, cytochrome c oxidase 17 (.1) AT1G53030 95 / 4e-27 Cytochrome C oxidase copper chaperone (COX17) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G119000 [exp] 137 / 4e-44 AT3G15352 97 / 2e-28 ARABIDOPSIS THALIANA CYTOCHROME C OXIDASE 17, cytochrome c oxidase 17 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035780 [exp] 103 / 2e-30 AT3G15352 103 / 5e-31 ARABIDOPSIS THALIANA CYTOCHROME C OXIDASE 17, cytochrome c oxidase 17 (.1) Lus10037356 [exp] 103 / 2e-30 AT3G15352 101 / 3e-30 ARABIDOPSIS THALIANA CYTOCHROME C OXIDASE 17, cytochrome c oxidase 17 (.1) Lus10018872 [exp] 92 / 4e-26 AT3G15352 94 / 3e-27 ARABIDOPSIS THALIANA CYTOCHROME C OXIDASE 17, cytochrome c oxidase 17 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0351 [poplar] [flax] CHCH PF05051 [poplar] [flax] COX17 Cytochrome C oxidase copper chaperone (COX17)
Representative CDS sequence Show only first row Show all	>Potri.001G400000.4 pacid=42793358 polypeptide=Potri.001G400000.4.p locus=Potri.001G400000 ID=Potri.001G400000.4.v4.1 annot-version=v4.1 ATGATTTTCTTCATTCCTTTCTTTATTTCTTTATGCCTTACATGTGTTTTCTGCAGATTTGTGATGGGTGGACTGCCTTTGCAAAATGCTTCCCCTACCC CAGTTGTCAGCCAGGTGTCAGTAATTACAAATTCTACTAAAGAATCAAAGCCCAAGAAGAAGATCTGCTGTGCTTGCCCTGAAACTAAGAAACTAAGGGA CGAATGCATTGTGGAGCATGGTGAAGCTGCATGTGCAAAATGGATTGAGGCTCATCGACTGTGCCTCCGTGCTGAGGGCTTTAACATTTGA
AA sequence Show only first row Show all	>Potri.001G400000.4 pacid=42793358 polypeptide=Potri.001G400000.4.p locus=Potri.001G400000 ID=Potri.001G400000.4.v4.1 annot-version=v4.1 MIFFIPFFISLCLTCVFCRFVMGGLPLQNASPTPVVSQVSVITNSTKESKPKKKICCACPETKKLRDECIVEHGEAACAKWIEAHRLCLRAEGFNI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G15352		ATCOX17	ARABIDOPSIS THALIANA CYTOCHROM...		Potri.001G400000 [exp]	0	1	ATCOX17.2
AT3G59380		FTA, PLP, ATFTA...	PLURIPETALA, farnesyltransfera...		Potri.007G127500 [exp]	1.73	0.8505	FTA.1
AT1G15270			Translation machinery associat...		Potri.001G181800 [exp]	5.29	0.8259
AT3G57870		SCE1A, SCE1, AH...	SUMO CONJUGATING ENZYME 1A, EM...		Potri.014G024950 [exp]	6.00	0.8360
AT2G37975			Yos1-like protein (.1)		Potri.016G109500 [exp]	8.12	0.8396
AT5G18200			UTP:galactose-1-phosphate urid...		Potri.019G034400 [exp]	15.87	0.8006
AT5G51880			2-oxoglutarate (2OG) and Fe(II...		Potri.015G135300 [exp]	22.00	0.8071
AT2G29700		ATPH1	pleckstrin homologue 1 (.1)		Potri.001G250400 [exp]	23.17	0.7287	Pt-ATPH1.2
AT3G13540	MYB	ATMYB5, ATM2	myb domain protein 5 (.1)		Potri.019G036160 [exp]	24.73	0.8040
AT1G75950		UIP1, SKP1A, AT...	UFO INTERACTING PROTEIN 1, ARA...		Potri.005G243100 [exp]	25.00	0.7421	Pt-SKP1.3
AT5G42190		SKP1B, ASK2	Arabidopsis SKP-like 2, E3 ubi...		Potri.004G175900 [exp]	32.07	0.7921	Pt-SKP1.5

Compare expression of checked genes

Potri.001G400000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.