Potri.001G400100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G15353 67 / 1e-16 ATMT3, MT3 metallothionein 3 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G118900 89 / 2e-25 AT3G15353 69 / 2e-17 metallothionein 3 (.1.2)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.001G400100.5 pacid=42790585 polypeptide=Potri.001G400100.5.p locus=Potri.001G400100 ID=Potri.001G400100.5.v4.1 annot-version=v4.1
ATGTCTAGCACCTGCGACAACTGCGACTGCGCTGACAAGACCCAGTGTGTCAAGAAGGGAAGCAGCTACACTGCTGGCATCGTCGAGACTGAGAAGAACT
ATGTCTCCTCCGTAGTCATGGAGGTGCCAGCAGCTGAGAACGATGGCAAGTGCAACTGCGGTACTGGCTGCACTTGCACTACCTGCACATGCGGTCATTA
A
AA sequence
>Potri.001G400100.5 pacid=42790585 polypeptide=Potri.001G400100.5.p locus=Potri.001G400100 ID=Potri.001G400100.5.v4.1 annot-version=v4.1
MSSTCDNCDCADKTQCVKKGSSYTAGIVETEKNYVSSVVMEVPAAENDGKCNCGTGCTCTTCTCGH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G15353 ATMT3, MT3 metallothionein 3 (.1.2) Potri.001G400100 0 1
AT4G02725 unknown protein Potri.005G210700 2.23 0.9689
AT4G36910 CBSX1, CDCP2, L... LOSS OF THE TIMING OF ET AND J... Potri.007G046400 7.74 0.9578
AT4G35220 Cyclase family protein (.1) Potri.001G301600 9.48 0.9431
AT5G26742 EMB1138 embryo defective 1138, DEAD bo... Potri.005G000500 11.31 0.9621
Potri.001G400200 15.68 0.9126
AT3G04650 FAD/NAD(P)-binding oxidoreduct... Potri.005G055800 20.19 0.9524
AT1G07230 NPC1 non-specific phospholipase C1 ... Potri.001G250500 22.29 0.9442
AT1G02560 NCLPP5, NCLPP1,... NUCLEAR CLPP 5, NUCLEAR-ENCODE... Potri.014G119700 23.34 0.9500
AT2G48070 RPH1 resistance to phytophthora 1 (... Potri.014G137300 25.80 0.9477
AT5G65380 MATE efflux family protein (.1... Potri.007G010200 31.30 0.9309

Potri.001G400100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.