Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20650 59 / 8e-11 RING/U-box superfamily protein (.1.2) AT1G04360 59 / 8e-11 RING/U-box superfamily protein (.1) AT2G24480 56 / 2e-10 Zinc finger, C3HC4 type (RING finger) family protein (.1) AT2G27940 56 / 4e-10 RING/U-box superfamily protein (.1) AT4G15975 56 / 4e-10 RING/U-box superfamily protein (.1) AT5G41440 54 / 4e-10 RING/U-box superfamily protein (.1) AT4G30370 54 / 9e-10 RING/U-box superfamily protein (.1) AT4G28890 56 / 1e-09 RING/U-box superfamily protein (.1) AT3G18773 55 / 1e-09 RING/U-box superfamily protein (.1) AT3G28620 55 / 1e-09 Zinc finger, C3HC4 type (RING finger) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G119900 [exp] 130 / 2e-39 AT1G14200 60 / 9e-12 RING/U-box superfamily protein (.1) Potri.010G245801 [exp] 96 / 9e-26 AT2G27940 61 / 1e-11 RING/U-box superfamily protein (.1) Potri.001G088400 [exp] 58 / 1e-10 AT4G24015 117 / 1e-32 RING/U-box superfamily protein (.1) Potri.007G139300 [exp] 58 / 1e-10 AT2G20650 867 / 0.0 RING/U-box superfamily protein (.1.2) Potri.008G071000 [exp] 56 / 3e-10 AT3G11110 122 / 3e-36 RING/U-box superfamily protein (.1) Potri.003G142600 [exp] 56 / 3e-10 AT4G24015 144 / 3e-43 RING/U-box superfamily protein (.1) Potri.010G010500 [exp] 56 / 4e-10 AT3G16720 202 / 1e-63 TOXICOS EN LEVADURA 2 (.1) Potri.002G153400 [exp] 55 / 8e-10 AT2G20030 83 / 8e-19 RING/U-box superfamily protein (.1) Potri.017G012600 [exp] 56 / 1e-09 AT2G20650 893 / 0.0 RING/U-box superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032418 [exp] 59 / 4e-11 AT4G24015 180 / 9e-58 RING/U-box superfamily protein (.1) Lus10023055 [exp] 57 / 2e-10 AT4G24015 181 / 5e-58 RING/U-box superfamily protein (.1) Lus10033425 [exp] 57 / 2e-10 AT3G10910 82 / 6e-20 RING/U-box superfamily protein (.1) Lus10040389 [exp] 57 / 4e-10 AT2G37150 191 / 1e-53 RING/U-box superfamily protein (.1.2.3) Lus10021524 [exp] 56 / 4e-10 AT3G20395 170 / 7e-53 RING/U-box superfamily protein (.1) Lus10023507 [exp] 57 / 5e-10 AT2G37150 138 / 4e-35 RING/U-box superfamily protein (.1.2.3) Lus10028454 [exp] 55 / 8e-10 AT1G72200 85 / 3e-19 RING/U-box superfamily protein (.1) Lus10006787 [exp] 55 / 1e-09 AT1G49230 159 / 9e-49 RING/U-box superfamily protein (.1) Lus10027736 [exp] 54 / 1e-09 AT4G17905 89 / 8e-22 RING/U-box superfamily protein (.1) Lus10016163 [exp] 54 / 2e-09 AT2G27940 133 / 1e-38 RING/U-box superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.001G400600.1 pacid=42789031 polypeptide=Potri.001G400600.1.p locus=Potri.001G400600 ID=Potri.001G400600.1.v4.1 annot-version=v4.1 ATGACAGAAGCTCCTTTTACTTCTGCTTCTGGCAACAATGAACACTTCCCTACTCTACTATTTATAATTATGGTTCTTGTTGCAGCGATATTGATCGTGA TATTTTATTTACTGTTAGAATTTTGTTTGAGGCATTTAGAATATCGGCGCCATGCTCTCCGTAACCAAGATCCTCGTCATCATCCTCATGATGTTGAAAG TGGGCAGGTAACTGGAAGACTCGAACCTGCTCCTCTTTCCATGTTGAAATTATATTATGTTCAAATCGATGAAAGCTCAGTCAATTTTAGCAGTGGATGT GTGATATGCTTGGATGATTTTCAGAAAGGGGAGAACTGCTGCGTTCTTTCCTCGTGCAAACATGTTTTCCATTCAGGATGTTTTATGCAATGGCTGGATA AGAATCAGAGCTGCCCTCTCTGTCGAGATCCTGTATGA
AA sequence Show only first row Show all	>Potri.001G400600.1 pacid=42789031 polypeptide=Potri.001G400600.1.p locus=Potri.001G400600 ID=Potri.001G400600.1.v4.1 annot-version=v4.1 MTEAPFTSASGNNEHFPTLLFIIMVLVAAILIVIFYLLLEFCLRHLEYRRHALRNQDPRHHPHDVESGQVTGRLEPAPLSMLKLYYVQIDESSVNFSSGC VICLDDFQKGENCCVLSSCKHVFHSGCFMQWLDKNQSCPLCRDPV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G20650			RING/U-box superfamily protein...		Potri.001G400600 [exp]	0	1
AT5G02740			Ribosomal protein S24e family ...		Potri.012G089800 [exp]	9.16	0.6707
					Potri.001G020080 [exp]	15.74	0.7571
AT5G47530			Auxin-responsive family protei...		Potri.019G096600 [exp]	22.91	0.6984
AT1G49330			hydroxyproline-rich glycoprote...		Potri.009G113900 [exp]	26.15	0.7116
AT3G24255			RNA-directed DNA polymerase (r...		Potri.010G000101 [exp]	28.56	0.7029
AT5G51600		ATMAP65-3, PLE	PLEIADE, ARABIDOPSIS THALIANA ...		Potri.006G269800 [exp]	28.72	0.7467
AT4G33010		ATGLDP1	glycine decarboxylase P-protei...		Potri.018G053720 [exp]	37.06	0.7200
AT5G38200			Class I glutamine amidotransfe...		Potri.010G120600 [exp]	46.73	0.6752
AT3G04280		ARR22	response regulator 22 (.1.2.3)		Potri.003G177400 [exp]	51.08	0.6032
AT1G15950		IRX4, ATCCR1, C...	IRREGULAR XYLEM 4, cinnamoyl c...		Potri.001G045000 [exp]	54.09	0.7071

Compare expression of checked genes

Potri.001G400600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.