Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G23220 110 / 1e-31 Dynein light chain type 1 family protein (.1) AT5G20110 104 / 3e-28 Dynein light chain type 1 family protein (.1) AT4G27360 81 / 2e-20 Dynein light chain type 1 family protein (.1) AT1G52240 74 / 6e-18 PIRF1, ATROPGEF11, ROPGEF11 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) AT4G15930 74 / 1e-17 Dynein light chain type 1 family protein (.1) AT3G16120 73 / 2e-17 Dynein light chain type 1 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G120400 [exp] 246 / 1e-84 AT1G23220 112 / 1e-32 Dynein light chain type 1 family protein (.1) Potri.001G124700 [exp] 144 / 1e-44 AT5G20110 116 / 3e-33 Dynein light chain type 1 family protein (.1) Potri.003G108700 [exp] 138 / 4e-42 AT5G20110 116 / 4e-33 Dynein light chain type 1 family protein (.1) Potri.010G108700 [exp] 117 / 3e-34 AT1G23220 187 / 2e-62 Dynein light chain type 1 family protein (.1) Potri.008G133000 [exp] 114 / 4e-33 AT1G23220 204 / 3e-69 Dynein light chain type 1 family protein (.1) Potri.015G067800 [exp] 95 / 6e-24 AT5G20110 142 / 3e-41 Dynein light chain type 1 family protein (.1) Potri.011G126400 [exp] 74 / 1e-17 AT4G27360 117 / 2e-35 Dynein light chain type 1 family protein (.1) Potri.001G407900 [exp] 74 / 1e-17 AT4G27360 126 / 5e-39 Dynein light chain type 1 family protein (.1) Potri.006G091800 [exp] 73 / 3e-17 AT1G52240 113 / 5e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034609 [exp] 117 / 2e-34 AT1G23220 181 / 4e-60 Dynein light chain type 1 family protein (.1) Lus10031734 [exp] 113 / 5e-33 AT1G23220 100 / 6e-29 Dynein light chain type 1 family protein (.1) Lus10021793 [exp] 114 / 7e-33 AT1G23220 176 / 6e-58 Dynein light chain type 1 family protein (.1) Lus10014484 [exp] 93 / 1e-23 AT5G20110 191 / 2e-61 Dynein light chain type 1 family protein (.1) Lus10030069 [exp] 88 / 8e-22 AT5G20110 201 / 2e-65 Dynein light chain type 1 family protein (.1) Lus10004252 [exp] 87 / 2e-20 AT1G69960 538 / 0.0 serine/threonine protein phosphatase 2A (.1) Lus10038566 [exp] 78 / 4e-19 AT4G27360 157 / 5e-51 Dynein light chain type 1 family protein (.1) Lus10035868 [exp] 77 / 5e-19 AT1G52240 174 / 2e-58 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10021496 [exp] 74 / 1e-17 AT1G52240 114 / 2e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10022596 [exp] 74 / 1e-17 AT1G52240 113 / 5e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01221 [poplar] [flax] Dynein_light Dynein light chain type 1
Representative CDS sequence Show only first row Show all	>Potri.001G401400.1 pacid=42791949 polypeptide=Potri.001G401400.1.p locus=Potri.001G401400 ID=Potri.001G401400.1.v4.1 annot-version=v4.1 ATGGATATCATTAAATCCCAAAGACAGAAAGAGGAGCAAGCTGCTGGCTTGAAACAACATTTTTTCACTGCTCAAAACAGACAAGAAGAAGCGACATTAA TAATGGCCCAAGATAGGTCTCCGACAGAGGAAGTCATGAAGCTAGCTGCCATTGCACTAAGCTTAAATGTAAGGCTAAGATCTTCCGACATGCCAGTCGA CATGCAAGAACGTGCCCTTCGCTATGCAAGATCATTTCTCGACGACCCATCAATATCATCAGCTCCCAAACACCGCCCCAATCCTACCCTCCTTGCTCGA GCCCTCAAAAAGGAATTTGACTCGGTATATGGGGTGGCCTGGCACTGTGTGGCGGGGAACAGTTTTGGGTCGTTTGTGACTCACTCACCAGGTGGGTTCA TGTACTTCTCTATCGACTCGCTGTTTATTGTTCTCTTCAAAACAGAGGTGAAGATGGTCACGGAATTGGAACCTTCTTCCCAGATCAGCTGA
AA sequence Show only first row Show all	>Potri.001G401400.1 pacid=42791949 polypeptide=Potri.001G401400.1.p locus=Potri.001G401400 ID=Potri.001G401400.1.v4.1 annot-version=v4.1 MDIIKSQRQKEEQAAGLKQHFFTAQNRQEEATLIMAQDRSPTEEVMKLAAIALSLNVRLRSSDMPVDMQERALRYARSFLDDPSISSAPKHRPNPTLLAR ALKKEFDSVYGVAWHCVAGNSFGSFVTHSPGGFMYFSIDSLFIVLFKTEVKMVTELEPSSQIS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G23220			Dynein light chain type 1 fami...		Potri.001G401400 [exp]	0	1
AT3G04100	MADS	AGL57	AGAMOUS-like 57 (.1)		Potri.004G130900 [exp]	15.16	0.7334
					Potri.004G204001 [exp]	50.37	0.5854
AT3G25400			unknown protein		Potri.010G069700 [exp]	50.37	0.7168
					Potri.019G129860 [exp]	100.00	0.6776
AT4G10270			Wound-responsive family protei...		Potri.019G117201 [exp]	141.74	0.5850
AT4G10270			Wound-responsive family protei...		Potri.019G117200 [exp]	143.55	0.6106
AT5G07610			F-box family protein (.1)		Potri.018G132800 [exp]	202.73	0.5772
					Potri.013G041350 [exp]	209.65	0.6485
AT3G24060			Plant self-incompatibility pro...		Potri.002G263900 [exp]	274.49	0.5890
AT2G42610		LSH10	LIGHT SENSITIVE HYPOCOTYLS 10,...		Potri.011G066400 [exp]	275.81	0.5923

Compare expression of checked genes

Potri.001G401400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.