Potri.001G401500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G15360 171 / 2e-54 ATHM4, ATM4, TRX-M4 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
AT4G03520 160 / 3e-50 ATHM2 Thioredoxin superfamily protein (.1.2)
AT1G03680 153 / 2e-47 ATHM1, ATM1, TRX-M1 ARABIDOPSIS THIOREDOXIN M-TYPE 1, thioredoxin M-type 1 (.1)
AT2G15570 108 / 6e-30 TRX-M3, GAT1, ATHM3, ATM3 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2)
AT1G76760 73 / 3e-16 ATY1, TRX-Y1 thioredoxin Y1 (.1)
AT1G43560 72 / 4e-16 ATY2 thioredoxin Y2 (.1)
AT1G19730 67 / 2e-14 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1)
AT5G39950 65 / 1e-13 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
AT3G51030 62 / 6e-13 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
AT1G52990 65 / 2e-12 thioredoxin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G120700 234 / 3e-79 AT3G15360 190 / 1e-61 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Potri.019G111200 170 / 8e-54 AT4G03520 172 / 9e-55 Thioredoxin superfamily protein (.1.2)
Potri.013G132200 166 / 3e-52 AT4G03520 173 / 4e-55 Thioredoxin superfamily protein (.1.2)
Potri.005G058400 160 / 2e-50 AT4G03520 157 / 6e-49 Thioredoxin superfamily protein (.1.2)
Potri.002G073000 158 / 3e-49 AT4G03520 152 / 6e-47 Thioredoxin superfamily protein (.1.2)
Potri.005G186800 154 / 1e-47 AT4G03520 152 / 3e-47 Thioredoxin superfamily protein (.1.2)
Potri.009G100700 111 / 4e-31 AT2G15570 193 / 2e-63 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2)
Potri.005G193400 76 / 3e-17 AT1G76760 198 / 2e-65 thioredoxin Y1 (.1)
Potri.002G066800 73 / 3e-16 AT1G76760 192 / 2e-63 thioredoxin Y1 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014798 186 / 2e-60 AT3G15360 181 / 2e-58 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Lus10040887 185 / 6e-60 AT3G15360 182 / 4e-59 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Lus10029755 161 / 1e-50 AT3G15360 162 / 3e-51 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Lus10029752 160 / 3e-50 AT3G15360 165 / 3e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Lus10042784 159 / 4e-50 AT3G15360 165 / 4e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Lus10019847 109 / 2e-30 AT2G15570 184 / 8e-60 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2)
Lus10014069 105 / 7e-29 AT2G15570 182 / 3e-59 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2)
Lus10018875 76 / 4e-17 AT1G76760 176 / 6e-57 thioredoxin Y1 (.1)
Lus10028569 75 / 6e-17 AT1G76760 174 / 3e-56 thioredoxin Y1 (.1)
Lus10030666 67 / 3e-14 AT5G39950 189 / 3e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF13098 Thioredoxin_2 Thioredoxin-like domain
Representative CDS sequence
>Potri.001G401500.3 pacid=42793711 polypeptide=Potri.001G401500.3.p locus=Potri.001G401500 ID=Potri.001G401500.3.v4.1 annot-version=v4.1
ATGGCTGCTCTTCTTGAATCCCTCACCGTTCCTCCTCTCACCTTCCCTAAACCTAAACCTACTACTACTACACCTCTCTGCGCTTTTGCTTCACCTATTC
ACCGGAGATCCCTTCGGTTACCACACGTCAAAGGCCTCAAGGCCTCCTTTAATTCGTCGACTATAAACCGCTCTCCTGGATCGTTCGTGACTCTCACCAG
TTCCAGACTCTCTCGTGGTGGACGGATTGTTTGTGAGGCGCAGGAGACTGCTGTCGAAGTGGCTTCTGTAACGGATGCAACATGGAAGTCAGTGGTGCTC
GAATCGGAATCCCCTGTGCTGGTTGAATTCTGGGCCCCATGGTGTGGTCCGTGCCGGATGATTCACCCTATAATCGATGAACTGGCCACGCAATATACTG
GTAAGCTCAAATGTTACAAAGTTAACACTGATGATTGCCCTTCCATTGCAACCCAATATGGGATTCGAAGCATTCCCACTGTTATCATCTTTAAAAATGG
TGAGAAGAAAGAGGCGATTATCGGTGCTGTTCCCAAAACTACCTTAACCACCACCATTGAGAAATTCTTGTAA
AA sequence
>Potri.001G401500.3 pacid=42793711 polypeptide=Potri.001G401500.3.p locus=Potri.001G401500 ID=Potri.001G401500.3.v4.1 annot-version=v4.1
MAALLESLTVPPLTFPKPKPTTTTPLCAFASPIHRRSLRLPHVKGLKASFNSSTINRSPGSFVTLTSSRLSRGGRIVCEAQETAVEVASVTDATWKSVVL
ESESPVLVEFWAPWCGPCRMIHPIIDELATQYTGKLKCYKVNTDDCPSIATQYGIRSIPTVIIFKNGEKKEAIIGAVPKTTLTTTIEKFL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G15360 ATHM4, ATM4, TR... ARABIDOPSIS THIOREDOXIN M-TYPE... Potri.001G401500 0 1
AT1G32580 plastid developmental protein ... Potri.010G068300 3.31 0.9678
AT3G54090 FLN1 fructokinase-like 1 (.1) Potri.016G109600 6.63 0.9674
AT5G48470 unknown protein Potri.002G251400 7.48 0.9597
AT2G38025 Cysteine proteinases superfami... Potri.016G110400 8.48 0.9654
AT4G29400 Protein of unknown function (D... Potri.014G148300 9.53 0.9562
AT4G04330 AtRbcX1 homologue of cyanobacterial Rb... Potri.011G010300 10.95 0.9595
AT2G34620 Mitochondrial transcription te... Potri.011G081400 13.07 0.9445
AT3G02660 EMB2768 EMBRYO DEFECTIVE 2768, Tyrosyl... Potri.014G140400 14.69 0.9577
AT3G09250 Nuclear transport factor 2 (NT... Potri.016G105600 16.91 0.9537
AT1G07700 Thioredoxin superfamily protei... Potri.014G029200 17.43 0.9523

Potri.001G401500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.