Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G09153 43 / 5e-07 LCR36 low-molecular-weight cysteine-rich 36 (.1) AT2G22121 43 / 6e-07 LCR35 low-molecular-weight cysteine-rich 35 (.1) AT4G29280 42 / 1e-06 LCR22 low-molecular-weight cysteine-rich 22 (.1) AT4G29283 40 / 6e-06 LCR21 low-molecular-weight cysteine-rich 21 (.1) AT4G29305 39 / 1e-05 LCR25 low-molecular-weight cysteine-rich 25 (.1) AT5G48905 38 / 4e-05 LCR12 low-molecular-weight cysteine-rich 12 (.1) AT4G29290 37 / 0.0002 LCR26 low-molecular-weight cysteine-rich 26 (.1) AT4G29273 35 / 0.0005 LCR23 low-molecular-weight cysteine-rich 23 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G195532 [exp] 43 / 8e-07 AT4G29280 46 / 5e-08 low-molecular-weight cysteine-rich 22 (.1) Potri.001G180750 [exp] 42 / 1e-06 AT4G29280 54 / 4e-11 low-molecular-weight cysteine-rich 22 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017233 [exp] 47 / 2e-08 AT5G48905 42 / 1e-06 low-molecular-weight cysteine-rich 12 (.1) Lus10015984 [exp] 46 / 3e-08 AT4G29280 47 / 1e-08 low-molecular-weight cysteine-rich 22 (.1) Lus10021078 [exp] 46 / 5e-08 AT5G48905 43 / 6e-07 low-molecular-weight cysteine-rich 12 (.1) Lus10015983 [exp] 41 / 4e-06 AT4G29280 41 / 3e-06 low-molecular-weight cysteine-rich 22 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0054 [poplar] [flax] Knottin_1 PF07333 [poplar] [flax] SLR1-BP S locus-related glycoprotein 1 binding pollen coat protein (SLR1-BP)
Representative CDS sequence Show only first row Show all	>Potri.001G401800.1 pacid=42788340 polypeptide=Potri.001G401800.1.p locus=Potri.001G401800 ID=Potri.001G401800.1.v4.1 annot-version=v4.1 ATGAAGCCTTTTTACTTGAGTTGCTTTATCTTAGCTTTGCTTCTCTTGACCTCCTCGGCGGAGATGATGGAAGTGATGAGAGATAACAATGGAAGGTGTG CCGCAGTGATGGACCCTGACGGATGCAATCTTTCATCTTGCAGGCAACGCTGTCTTCAGCAGAAGAATGGCAATGGTGTTTGTCTGGCCAATTTGAAGGG GGGGAGTTACCAATGTGTTTGTTACGTAAATTGTTAA
AA sequence Show only first row Show all	>Potri.001G401800.1 pacid=42788340 polypeptide=Potri.001G401800.1.p locus=Potri.001G401800 ID=Potri.001G401800.1.v4.1 annot-version=v4.1 MKPFYLSCFILALLLLTSSAEMMEVMRDNNGRCAAVMDPDGCNLSSCRQRCLQQKNGNGVCLANLKGGSYQCVCYVNC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G09153		LCR36	low-molecular-weight cysteine-...		Potri.001G401800 [exp]	0	1
AT1G04570			Major facilitator superfamily ...		Potri.008G173600 [exp]	2.23	0.8133
AT2G44990		MAX3, CCD7, ATC...	carotenoid cleavage dioxygenas...		Potri.014G056800 [exp]	3.74	0.8005
AT2G30130	AS2	PCK1, LBD12, AS...	PEACOCK 1, Lateral organ bound...		Potri.008G072800 [exp]	10.72	0.7935
					Potri.010G173050 [exp]	20.71	0.7696
					Potri.002G177700 [exp]	21.26	0.7953
AT3G23000		PKS7, ATSRPK1, ...	SNF1-RELATED PROTEIN KINASE 3....		Potri.008G160200 [exp]	24.79	0.7359	CIPK4.1
AT3G62150		ABCB21, PGP21	ATP-binding cassette B21, P-gl...		Potri.014G113400 [exp]	28.08	0.7960
AT3G12830			SAUR-like auxin-responsive pro...		Potri.003G070900 [exp]	41.78	0.7884	SAUR14
AT5G45160			Root hair defective 3 GTP-bind...		Potri.012G117001 [exp]	47.83	0.7824
AT3G50810			Uncharacterised protein family...		Potri.009G110200 [exp]	55.65	0.6896

Compare expression of checked genes

Potri.001G401800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.