Potri.001G402000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G15395 79 / 1e-21 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G225232 86 / 2e-24 AT3G15395 58 / 3e-13 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039067 83 / 2e-23 AT3G15395 83 / 3e-23 unknown protein
Lus10027849 83 / 4e-23 AT3G15395 83 / 2e-23 unknown protein
Lus10038792 76 / 1e-20 AT3G15395 80 / 3e-22 unknown protein
PFAM info
Representative CDS sequence
>Potri.001G402000.2 pacid=42789619 polypeptide=Potri.001G402000.2.p locus=Potri.001G402000 ID=Potri.001G402000.2.v4.1 annot-version=v4.1
ATGGGAGGCCGAGGAGTTATTGGTGATAAATGGTCCTCGAGGGTTCTTTGGGCCTGTGCTATTGGAAGTGTAGTCAGCCTGTATATGGTTGTTGTTGAAA
GACAATTACAAAACAGGGAACGAATGATGGCTGAAGGTTTAAAGAATATTGATGCGGAATCAGGCGCTGGTGACAATGTTTAA
AA sequence
>Potri.001G402000.2 pacid=42789619 polypeptide=Potri.001G402000.2.p locus=Potri.001G402000 ID=Potri.001G402000.2.v4.1 annot-version=v4.1
MGGRGVIGDKWSSRVLWACAIGSVVSLYMVVVERQLQNRERMMAEGLKNIDAESGAGDNV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G15395 unknown protein Potri.001G402000 0 1
AT1G68000 ATPIS1 phosphatidylinositol synthase ... Potri.009G135500 1.73 0.8828
AT5G18800 Cox19-like CHCH family protein... Potri.010G026000 2.82 0.8835
AT1G77350 unknown protein Potri.019G066600 3.00 0.9194
AT1G77710 unknown protein Potri.002G087200 4.89 0.8708
AT4G39740 HCC2 homologue of copper chaperone ... Potri.007G091300 5.19 0.8390
AT4G38240 GNTI, CGL1 N-ACETYLGLUCOSAMINYLTRANSFERAS... Potri.004G206900 5.65 0.8566
AT1G12390 Cornichon family protein (.1) Potri.003G116400 6.00 0.8629
AT3G58130 N-acetylglucosaminylphosphatid... Potri.012G041700 8.00 0.8756
AT3G50860 Clathrin adaptor complex small... Potri.007G025400 9.48 0.8612
AT1G07080 Thioredoxin superfamily protei... Potri.006G103000 9.84 0.7902

Potri.001G402000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.