Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G15480 107 / 2e-29 Protein of unknown function (DUF1218) (.1) AT1G61065 96 / 5e-25 Protein of unknown function (DUF1218) (.1) AT1G52910 96 / 8e-25 Protein of unknown function (DUF1218) (.1) AT4G27435 94 / 2e-24 Protein of unknown function (DUF1218) (.1) AT1G68220 80 / 1e-18 Protein of unknown function (DUF1218) (.1) AT1G13380 64 / 6e-13 Protein of unknown function (DUF1218) (.1) AT5G17210 44 / 1e-05 Protein of unknown function (DUF1218) (.1), Protein of unknown function (DUF1218) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G122700 [exp] 105 / 7e-29 AT4G27435 213 / 3e-71 Protein of unknown function (DUF1218) (.1) Potri.001G403600 [exp] 105 / 9e-29 AT4G27435 218 / 3e-73 Protein of unknown function (DUF1218) (.1) Potri.008G124100 [exp] 77 / 1e-17 AT1G68220 273 / 3e-94 Protein of unknown function (DUF1218) (.1) Potri.010G120500 [exp] 76 / 3e-17 AT1G68220 284 / 2e-98 Protein of unknown function (DUF1218) (.1) Potri.008G120900 [exp] 74 / 2e-16 AT1G13380 200 / 9e-66 Protein of unknown function (DUF1218) (.1) Potri.004G038700 [exp] 72 / 7e-16 AT1G61065 205 / 6e-68 Protein of unknown function (DUF1218) (.1) Potri.010G124800 [exp] 71 / 3e-15 AT1G13380 208 / 6e-69 Protein of unknown function (DUF1218) (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043091 [exp] 105 / 1e-28 AT3G15480 258 / 7e-89 Protein of unknown function (DUF1218) (.1) Lus10032662 [exp] 105 / 1e-28 AT3G15480 256 / 3e-88 Protein of unknown function (DUF1218) (.1) Lus10018474 [exp] 83 / 5e-20 AT1G61065 219 / 2e-73 Protein of unknown function (DUF1218) (.1) Lus10032663 [exp] 77 / 1e-17 AT4G27435 103 / 4e-28 Protein of unknown function (DUF1218) (.1) Lus10034324 [exp] 76 / 5e-17 AT1G13380 275 / 2e-95 Protein of unknown function (DUF1218) (.1) Lus10041447 [exp] 76 / 6e-17 AT1G13380 273 / 1e-94 Protein of unknown function (DUF1218) (.1) Lus10043484 [exp] 75 / 8e-17 AT1G68220 276 / 2e-95 Protein of unknown function (DUF1218) (.1) Lus10034105 [exp] 75 / 7e-16 AT1G31860 367 / 1e-125 HISTIDINE BIOSYNTHESIS 2, histidine biosynthesis bifunctional protein (HISIE) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06749 [poplar] [flax] DUF1218 Protein of unknown function (DUF1218)
Representative CDS sequence Show only first row Show all	>Potri.001G403500.3 pacid=42792530 polypeptide=Potri.001G403500.3.p locus=Potri.001G403500 ID=Potri.001G403500.3.v4.1 annot-version=v4.1 ATGGCATCAACACTTGTGTTCATGGCGATCTTTGCCATTGATTTCATTGCTTTTGTCCTTGCCCTTGCAGCTGAACATATGAGAAGTACTGCCAAGGCTG CTACTGACAGTGACTCAAGCTATAGCTACTGCGTCTACAGCTCAGACATTGCAACAAAGTTGGGAGCTATTGCATTTGTTTTACTTTTGGCAAGTCAAGT TTTCTCAATGGGTGCTAGCTCCTACTTTCGAAAGGGTATGAACTATGGAGGTAGTAGGACATCTGCTGTCATCCCATCCATAATAAGCTGGATTACATTC TTCATTGCTGAGGCATGCTTACTGGGTGGTGCAATCAAGAATGCTCAACACACCAAATACAGGACCATATCAGGCACTGATGGGCTTCGTTGCCAGACCT TAAGCGCGGGAGCTTTTGAGGCAGGAGCAGCCTTCATATTGATCACCAGCATAGTTTCTAAGATGAGCTATGTCTGCTTTTTCAACTCCGATGGAGGATT TGAGACGGGCAGTAGCAGCAGCTGTGAATTGGGAACCTACACTTCACTTAATCAAGGTGATCAACATGATTAA
AA sequence Show only first row Show all	>Potri.001G403500.3 pacid=42792530 polypeptide=Potri.001G403500.3.p locus=Potri.001G403500 ID=Potri.001G403500.3.v4.1 annot-version=v4.1 MASTLVFMAIFAIDFIAFVLALAAEHMRSTAKAATDSDSSYSYCVYSSDIATKLGAIAFVLLLASQVFSMGASSYFRKGMNYGGSRTSAVIPSIISWITF FIAEACLLGGAIKNAQHTKYRTISGTDGLRCQTLSAGAFEAGAAFILITSIVSKMSYVCFFNSDGGFETGSSSSCELGTYTSLNQGDQHD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G15480			Protein of unknown function (D...		Potri.001G403500 [exp]	0	1
AT1G16290			unknown protein		Potri.008G084100 [exp]	4.79	0.8442
AT3G04810		ATNEK2	NIMA-related kinase 2 (.1.2)		Potri.002G049400 [exp]	5.29	0.8413
AT4G28640	AUX_IAA	IAA11	indole-3-acetic acid inducible...		Potri.006G066600 [exp]	7.34	0.7987
AT1G14340			RNA-binding (RRM/RBD/RNP motif...		Potri.017G081400 [exp]	9.16	0.7778
AT4G35550	HD	HB-4, WOX13, AT...	WUSCHEL related homeobox 13 (....		Potri.002G008800 [exp]	13.03	0.8137	HB1.3
AT5G47635			Pollen Ole e 1 allergen and ex...		Potri.006G005600 [exp]	13.74	0.8169
AT3G23090			TPX2 (targeting protein for Xk...		Potri.008G162800 [exp]	17.20	0.8147
AT4G01710		ARPC5, CRK	CROOKED, ARP2/3 complex 16 kDa...		Potri.014G045200 [exp]	19.44	0.7864	Pt-CRK.1
AT5G47180			Plant VAMP (vesicle-associated...		Potri.001G152100 [exp]	21.49	0.7827
AT5G59350			unknown protein		Potri.008G054400 [exp]	22.91	0.7936

Compare expression of checked genes

Potri.001G403500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.