Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G52900 233 / 2e-78 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G61105 214 / 6e-71 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT5G48770 80 / 2e-17 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G17615 79 / 4e-17 Disease resistance protein (TIR-NBS class) (.1) AT1G72930 74 / 1e-16 TIR toll/interleukin-1 receptor-like (.1.2) AT1G72840 76 / 4e-16 Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2) AT1G72920 74 / 9e-16 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G72950 74 / 2e-15 Disease resistance protein (TIR-NBS class) (.1) AT1G72940 73 / 4e-15 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT1G72860 73 / 6e-15 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G123100 [exp] 346 / 2e-123 AT1G52900 229 / 2e-77 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.004G038200 [exp] 259 / 1e-88 AT1G61105 233 / 1e-78 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.011G046800 [exp] 252 / 5e-86 AT1G61105 230 / 1e-77 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.019G016425 [exp] 84 / 7e-19 AT5G36930 650 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G052000 [exp] 84 / 1e-18 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.007G143100 [exp] 82 / 1e-18 AT5G36930 234 / 1e-69 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G019053 [exp] 83 / 2e-18 AT5G36930 655 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.015G043501 [exp] 82 / 2e-18 AT1G27170 534 / 5e-176 transmembrane receptors;ATP binding (.1.2) Potri.015G043600 [exp] 82 / 3e-18 AT1G27170 1195 / 0.0 transmembrane receptors;ATP binding (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011216 [exp] 242 / 8e-82 AT1G61105 228 / 2e-76 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Lus10018470 [exp] 238 / 2e-80 AT1G61105 224 / 5e-75 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Lus10012311 [exp] 81 / 9e-18 AT5G36930 354 / 6e-103 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10040576 [exp] 79 / 6e-17 AT1G27180 355 / 3e-103 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10007823 [exp] 78 / 1e-16 AT1G27170 322 / 3e-92 transmembrane receptors;ATP binding (.1.2) Lus10004747 [exp] 78 / 1e-16 AT5G36930 342 / 3e-99 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10000423 [exp] 77 / 2e-16 AT1G27180 338 / 5e-95 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10007829 [exp] 77 / 3e-16 AT5G36930 330 / 2e-94 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10007821 [exp] 75 / 1e-15 AT5G36930 339 / 4e-98 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10015453 [exp] 74 / 2e-15 AT1G27170 282 / 5e-84 transmembrane receptors;ATP binding (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [poplar] [flax] STIR PF01582 [poplar] [flax] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Potri.001G403800.1 pacid=42787704 polypeptide=Potri.001G403800.1.p locus=Potri.001G403800 ID=Potri.001G403800.1.v4.1 annot-version=v4.1 ATGAATCGCTCTTCAATTGTAAACTTCCCACGCCAATTTCTCCGTCAATACCCCTCAATACAGCCGGCGGTTACCAGTCGTATTGCCAAACCTTGTGATG TGTTCATTAACCATCGAGGGATCGACACAAAGCGCACGGTTGTTACTTTGCTTTATGATCACCTTTTCCGGTTAAACCTACACCCCTTCCTGGACAACAA GAATATGAAGCCAGGAGACAAGTTGTTCGATAATATCAACAGTGCAATAAGGAAATGTAAGGTTGGGGTGACTGTGTTTTCTCCTCGGTATTGCGAGTCA TATTTTTGCCTTCATGAACTAGCTCTTATTATGGAGTCAAAGAAGAAGGTTATTCCTATCTTTTGTGACATCAAGCCCTCGCAACTTCGAGTTGTGAACG ATGGGAAATGTCCCATGGAGGATATCCGGAGGTTTCGCTGGGCACTTGAAGAGGCTAAGTATACTGTAGGGCTCACGTTCGACTCCTTGAAAGGGAACTG GTCGGAGGTTGTAACAAGTGCGTCGGATATTGTCATTGAAACCTTGGTTGAGCTCGAGAGTGAGAAGCAAATGCAGCGCCATAAAAGCACTCCAATATTC CGTGCCTAG
AA sequence Show only first row Show all	>Potri.001G403800.1 pacid=42787704 polypeptide=Potri.001G403800.1.p locus=Potri.001G403800 ID=Potri.001G403800.1.v4.1 annot-version=v4.1 MNRSSIVNFPRQFLRQYPSIQPAVTSRIAKPCDVFINHRGIDTKRTVVTLLYDHLFRLNLHPFLDNKNMKPGDKLFDNINSAIRKCKVGVTVFSPRYCES YFCLHELALIMESKKKVIPIFCDIKPSQLRVVNDGKCPMEDIRRFRWALEEAKYTVGLTFDSLKGNWSEVVTSASDIVIETLVELESEKQMQRHKSTPIF RA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G52900			Toll-Interleukin-Resistance (T...		Potri.001G403800 [exp]	0	1
					Potri.001G169351 [exp]	5.29	1.0000
					Potri.001G196900 [exp]	7.48	1.0000
AT3G28007		SWEET4, AtSWEET...	Nodulin MtN3 family protein (....		Potri.001G344300 [exp]	9.16	1.0000
					Potri.002G092751 [exp]	11.22	1.0000
					Potri.003G015466 [exp]	11.83	1.0000
AT5G18990			Pectin lyase-like superfamily ...		Potri.004G033700 [exp]	11.95	1.0000
					Potri.003G072050 [exp]	12.40	1.0000
AT1G30190			unknown protein		Potri.004G065300 [exp]	14.00	1.0000
AT1G16730		UP6	unknown protein 6 (.1)		Potri.007G003700 [exp]	17.14	1.0000
AT1G69180	YABBY	CRC	CRABS CLAW, Plant-specific tra...		Potri.008G097800 [exp]	18.70	1.0000	CRC.1

Compare expression of checked genes

Potri.001G403800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.