Plant FIBer expression Database

Potri.001G404500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G15518 67 / 2e-15 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G123600
[exp]
155 / 2e-50 AT3G15518 64 / 2e-14 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037893
[exp]
37 / 0.0004 AT3G15518 64 / 2e-14 unknown protein
PFAM info
Representative CDS sequence
>Potri.001G404500.1 pacid=42788574 polypeptide=Potri.001G404500.1.p locus=Potri.001G404500 ID=Potri.001G404500.1.v4.1 annot-version=v4.1
ATGGAAACCATCTCCCAAAAACAGACTAGAGGAAGGCTCCAACCTCCAGCAAGACAGTCACTTGGTGAGGGCAACAGGGTTAGGAGAAATAATCAAGTAG
CGTCCATCTCTCCTAGGCCACGGTCAACTTGTACGTGCTCAAACCGTCCGGGGTCAGTCAGGTGTAGCAAGCACGGCTATCTGGTGCCTAGTGACAAGTT
AAGAAGAAATCAAGCAAATACAGAGATATTAAGGAGGGCTTTAGCACCACCAAATCGGAGGTTAACCCTTCGGTGGTTTAACTTCCAGCCAACGCCTAGT
CGGCTTTCTAACATGTCCATGGCATAG
AA sequence
>Potri.001G404500.1 pacid=42788574 polypeptide=Potri.001G404500.1.p locus=Potri.001G404500 ID=Potri.001G404500.1.v4.1 annot-version=v4.1
METISQKQTRGRLQPPARQSLGEGNRVRRNNQVASISPRPRSTCTCSNRPGSVRCSKHGYLVPSDKLRRNQANTEILRRALAPPNRRLTLRWFNFQPTPS
RLSNMSMA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G15518 unknown protein Potri.001G404500
[exp]
0 1
AT4G32870 Polyketide cyclase/dehydrase a... Potri.006G237100
[exp]
2.00 0.9083
Potri.010G015100
[exp]
2.82 0.8978
AT4G32480 Protein of unknown function (D... Potri.019G074400
[exp]
2.82 0.8382
AT5G46295 unknown protein Potri.011G079900
[exp]
4.47 0.8566
AT1G23380 HD KNAT6S, KNAT6L,... KNOTTED1-like homeobox gene 6 ... Potri.010G043500
[exp]
5.19 0.8724
Potri.014G032100
[exp]
8.66 0.8209
AT3G07500 FAR1_related Far-red impaired responsive (F... Potri.007G128800
[exp]
9.05 0.7626
AT1G77160 Protein of unknown function (D... Potri.002G071500
[exp]
10.58 0.8411
AT4G33565 RING/U-box superfamily protein... Potri.007G111900
[exp]
14.49 0.8211
AT1G14590 Nucleotide-diphospho-sugar tra... Potri.015G029200
[exp]
15.71 0.8143

Potri.001G404500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.