Plant FIBer expression Database

Potri.001G404951 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATMG00740 40 / 5e-05 ATMG00740.1, ORF100A unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G204350
[exp]
197 / 6e-61 ATMG00750 45 / 9e-06 GAG/POL/ENV polyprotein (.1)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.001G404951.1 pacid=42789512 polypeptide=Potri.001G404951.1.p locus=Potri.001G404951 ID=Potri.001G404951.1.v4.1 annot-version=v4.1
ATGACCAAACAAAGGGAAGTCAATCACGATTCTGAAATCTTTGAAGCTTTCAAACAGGAAGAAATTGAGGACAAGAAAGGCACCGAAAATGTTGTCGCGG
ATCATTTGTCAAGATTGACAATAGATTCCACATCTAACATCACATCAATTGATGATTACTTTCCTAATGAATCTTCACTTTCTGTTGCTTCAATACCTTG
TTCTGCTAATATTGACAATTTACTTGCTTTAGGATTTTTGCCAGCTCATTGGAATACCCAAGACAAAAGAAATTTTTTGAGCGAAGTGAAAAACTTTTAT
TGGGATGACCCTTACTTATTCAAATATTATCTTGATCAAATATTTCAAAGAAGCATTCCCGATAATAACTTAAGTAGTGTCATTAAATTTTGTCATTTTG
AGGCATGTGGGGGTCATTTCTCGTCAAAAAAGACAGCTGCAAAAATCTTACAAAATGGATTTTATTAG
AA sequence
>Potri.001G404951.1 pacid=42789512 polypeptide=Potri.001G404951.1.p locus=Potri.001G404951 ID=Potri.001G404951.1.v4.1 annot-version=v4.1
MTKQREVNHDSEIFEAFKQEEIEDKKGTENVVADHLSRLTIDSTSNITSIDDYFPNESSLSVASIPCSANIDNLLALGFLPAHWNTQDKRNFLSEVKNFY
WDDPYLFKYYLDQIFQRSIPDNNLSSVIKFCHFEACGGHFSSKKTAAKILQNGFY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.001G404951
[exp]
0 1
Potri.005G134850
[exp]
12.40 0.8556
AT3G46130 MYB PFG3, ATMYB111 ... myb domain protein 48 (.1.2.3.... Potri.001G235500
[exp]
18.33 0.8520 Pt-MYB111.2,MYB206
Potri.014G093150
[exp]
22.58 0.8471
Potri.006G040201
[exp]
25.09 0.8469
AT1G43760 DNAse I-like superfamily prote... Potri.014G189001
[exp]
32.44 0.8381
AT4G13970 zinc ion binding (.1) Potri.002G140800
[exp]
34.46 0.8112
Potri.005G152000
[exp]
36.33 0.8178
AT1G28300 B3 LEC2 LEAFY COTYLEDON 2, AP2/B3-like... Potri.004G045800
[exp]
36.82 0.8283
Potri.010G122150
[exp]
40.98 0.8171
AT5G47010 ATUPF1, UPF1, L... LOW-LEVEL BETA-AMYLASE 1, RNA ... Potri.001G148100
[exp]
42.64 0.8229

Potri.001G404951 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.