Plant FIBer expression Database

Potri.001G407650 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G407300
[exp]
39 / 9e-05 AT5G54260 1054 / 0.0 ARABIDOPSIS MEIOTIC RECOMBINATION 11, DNA repair and meiosis protein (Mre11) (.1)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.001G407650.1 pacid=42788737 polypeptide=Potri.001G407650.1.p locus=Potri.001G407650 ID=Potri.001G407650.1.v4.1 annot-version=v4.1
ATGCAATGCAATGCAGATGCTAGGAACAACCCAGTAAAAAAAAAAAAAACAAGAGAGAGAGAAGTGTGGAACTATTTTCTGCCCATATCCGAGTGTCTTC
ATTTCTGCTTTGAAATTCACCGCCACCGCAACACCCTTTCTACTCCTTTCAATCCCAAAATCAAACGGTTTTTGAAGAGGAAGACTTGTCAAGGGATGAT
GTTGCAAATACGCTTCGAGTACTTGTTGCAACGGATTGTCATCTAG
AA sequence
>Potri.001G407650.1 pacid=42788737 polypeptide=Potri.001G407650.1.p locus=Potri.001G407650 ID=Potri.001G407650.1.v4.1 annot-version=v4.1
MQCNADARNNPVKKKKTREREVWNYFLPISECLHFCFEIHRHRNTLSTPFNPKIKRFLKRKTCQGMMLQIRFEYLLQRIVI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.001G407650
[exp]
0 1
AT5G17370 Transducin/WD40 repeat-like su... Potri.003G155900
[exp]
4.24 0.8432
AT3G02065 P-loop containing nucleoside t... Potri.014G140100
[exp]
5.47 0.8405
AT1G13040 Pentatricopeptide repeat (PPR-... Potri.008G185000
[exp]
11.35 0.8334
AT2G39550 GGB, ATGGT-IB, ... GERANYLGERANYLTRANSFERASE-I BE... Potri.010G206001
[exp]
11.48 0.8053
AT5G46190 RNA-binding KH domain-containi... Potri.011G082500
[exp]
17.43 0.8317
AT2G40360 Transducin/WD40 repeat-like su... Potri.003G009600
[exp]
22.58 0.8277
AT5G02770 MOS11 modifier of snc1, 11, unknown ... Potri.016G082900
[exp]
24.24 0.7872
AT1G08970 CCAAT NF-YC9, HAP5C "nuclear factor Y, subunit C9"... Potri.010G032301
[exp]
26.98 0.8028
AT2G38730 Cyclophilin-like peptidyl-prol... Potri.003G194500
[exp]
30.00 0.7928
AT3G55560 AT-hook AHL15, AGF2 AT-hook motif nuclear-localize... Potri.008G058700
[exp]
31.46 0.8062

Potri.001G407650 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.