Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G54580 174 / 2e-56 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT2G37510 99 / 3e-27 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT1G73530 87 / 5e-22 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G06210 83 / 9e-21 RNA binding (RRM/RBD/RNP motifs) family protein (.1) AT1G18630 72 / 2e-16 GR-RBP6 glycine-rich RNA-binding protein 6 (.1) AT3G20930 74 / 3e-16 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G46020 70 / 3e-16 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G26420 73 / 4e-16 ATRZ-1A RZ-1A, RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.1) AT5G61030 72 / 1e-15 GR-RBP3 glycine-rich RNA-binding protein 3 (.1) AT1G74230 71 / 2e-15 GR-RBP5 glycine-rich RNA-binding protein 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G130300 [exp] 206 / 3e-69 AT5G54580 161 / 2e-51 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.012G038200 [exp] 92 / 5e-24 AT1G73530 141 / 6e-43 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.001G319900 [exp] 84 / 3e-21 AT4G13850 140 / 1e-43 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Potri.006G208500 [exp] 84 / 4e-21 AT5G06210 160 / 1e-51 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Potri.017G059000 [exp] 83 / 4e-21 AT4G13850 134 / 9e-42 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Potri.008G022280 [exp] 78 / 5e-19 AT3G20930 203 / 2e-65 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.015G057400 [exp] 79 / 1e-18 AT5G61030 157 / 8e-47 glycine-rich RNA-binding protein 3 (.1) Potri.012G061600 [exp] 77 / 1e-17 AT5G61030 181 / 9e-56 glycine-rich RNA-binding protein 3 (.1) Potri.001G207100 [exp] 76 / 1e-17 AT3G26420 175 / 7e-55 RZ-1A, RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014802 [exp] 174 / 5e-54 AT5G54580 176 / 2e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10003593 [exp] 172 / 3e-53 AT5G54580 174 / 6e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10003980 [exp] 103 / 1e-28 AT2G37510 169 / 1e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10023758 [exp] 100 / 2e-27 AT2G37510 164 / 9e-53 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10029426 [exp] 81 / 2e-18 AT5G27720 190 / 2e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Lus10022551 [exp] 75 / 1e-17 AT4G13850 167 / 7e-54 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Lus10021154 [exp] 77 / 2e-17 AT5G61030 188 / 5e-58 glycine-rich RNA-binding protein 3 (.1) Lus10043158 [exp] 74 / 2e-17 AT4G13850 154 / 1e-48 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Lus10016639 [exp] 74 / 2e-17 AT4G13850 166 / 1e-53 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) Lus10032591 [exp] 74 / 3e-17 AT4G13850 157 / 5e-50 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.001G409800.1 pacid=42790228 polypeptide=Potri.001G409800.1.p locus=Potri.001G409800 ID=Potri.001G409800.1.v4.1 annot-version=v4.1 ATGGCCATGAGAGCAACGATGTCGGCTTTGGCTGCGGCAGCTGCAGCTCCCCGTGGTGGTTTGCTGCGGCTGTTGTCAACAACTTCTACTTTATCCTTCT CCTTCCCTTTTCCTCAGACCACTCAGCAAACTCCTGCACGAGAACAGGCTGAACCCAACACCAATCTCTTCGTATCTGGGCTAAGTAAAAGAACAACAAC AGAGGGACTCCAAGAGGCCTTTTCTAAATTTGGTGAAGTGGTTCAAGCTAAAGTTGTAACTGACAGGACCTCAGGTTATTCTAAGGGGTTTGGTTTTGTC AGATATGGTACCTTAGAAGATGCTGCAGAAGGAATAAAAGGCATGGATGGACAGTTTCTGGATGGATGGGTTATATTTGCAGAGTATGCAAGACCCAAAC AACCACCTTCTCAACCCCAGAACAACATGGGTCCAGGATATGGAAACTAG
AA sequence Show only first row Show all	>Potri.001G409800.1 pacid=42790228 polypeptide=Potri.001G409800.1.p locus=Potri.001G409800 ID=Potri.001G409800.1.v4.1 annot-version=v4.1 MAMRATMSALAAAAAAPRGGLLRLLSTTSTLSFSFPFPQTTQQTPAREQAEPNTNLFVSGLSKRTTTEGLQEAFSKFGEVVQAKVVTDRTSGYSKGFGFV RYGTLEDAAEGIKGMDGQFLDGWVIFAEYARPKQPPSQPQNNMGPGYGN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G54580			RNA-binding (RRM/RBD/RNP motif...		Potri.001G409800 [exp]	0	1
AT3G11500			Small nuclear ribonucleoprotei...		Potri.006G211100 [exp]	1.41	0.9180
AT5G64670			Ribosomal protein L18e/L15 sup...		Potri.001G324300 [exp]	2.00	0.9158
AT3G49320			Metal-dependent protein hydrol...		Potri.015G007900 [exp]	2.00	0.9190
AT5G62290			nucleotide-sensitive chloride ...		Potri.012G128500 [exp]	3.46	0.9043
AT4G26055			unknown protein		Potri.010G204200 [exp]	5.09	0.8871
AT5G53070			Ribosomal protein L9/RNase H1 ...		Potri.012G017300 [exp]	5.19	0.9017
AT5G14590			Isocitrate/isopropylmalate deh...		Potri.001G347800 [exp]	5.29	0.8705
AT3G27740		VEN6, CARA	VENOSA 6, carbamoyl phosphate ...		Potri.003G080900 [exp]	5.65	0.9018	Pt-CARA.2
AT4G30930		WRKY32, NFD1	NUCLEAR FUSION DEFECTIVE 1, Ri...		Potri.015G095700 [exp]	5.91	0.9043	Pt-RPL21.5
AT3G49660		AtWDR5a	human WDR5 \(WD40 repeat\) hom...		Potri.007G009500 [exp]	10.09	0.9165

Compare expression of checked genes

Potri.001G409800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.