Potri.001G410554 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.001G410554.1 pacid=42793423 polypeptide=Potri.001G410554.1.p locus=Potri.001G410554 ID=Potri.001G410554.1.v4.1 annot-version=v4.1
ATGCAAATGCTCCAACTTTCCAATATAAAGGTGTTTCAGATGTGGTTTTCATATGGAATCAATCCTGCTTTTGATTCAAGACTGTCCTATATCCAAGGAT
GTGTGTGTGGTGCGCTTGCATACAAAACAGCAGGGACACGAAGATGTGGACGAGCCGCCAGATTATTACTCTTCATGAAGTTCATACTCAGTTGA
AA sequence
>Potri.001G410554.1 pacid=42793423 polypeptide=Potri.001G410554.1.p locus=Potri.001G410554 ID=Potri.001G410554.1.v4.1 annot-version=v4.1
MQMLQLSNIKVFQMWFSYGINPAFDSRLSYIQGCVCGALAYKTAGTRRCGRAARLLLFMKFILS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.001G410554 0 1
AT5G51810 AT2353, GA20OX2... gibberellin 20 oxidase 2 (.1) Potri.012G132400 2.00 0.9052 Pt-GA20.1,GA20ox6
AT3G14720 ATMPK19 ARABIDOPSIS THALIANA MAP KINAS... Potri.011G102500 2.44 0.9003 Pt-TDY1.1
AT4G08850 Leucine-rich repeat receptor-l... Potri.019G129300 4.47 0.8936
AT3G48660 Protein of unknown function (D... Potri.015G098300 4.89 0.8536
AT1G23210 ATGH9B6 glycosyl hydrolase 9B6 (.1) Potri.015G127900 7.48 0.8758
AT5G43020 Leucine-rich repeat protein ki... Potri.014G024400 8.94 0.8537
AT4G31500 SUR2, RNT1, RED... SUPERROOT 2, RUNT 1, RED ELONG... Potri.002G026100 9.38 0.8537
AT3G47570 Leucine-rich repeat protein ki... Potri.005G031300 11.61 0.8452
AT4G31940 CYP82C4 "cytochrome P450, family 82, s... Potri.014G038100 12.00 0.8443
AT1G78955 CAMS1 camelliol C synthase 1 (.1) Potri.001G049100 14.07 0.8394

Potri.001G410554 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.