Potri.001G412377 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G65790 206 / 2e-62 ARK1 receptor kinase 1 (.1)
AT4G27290 204 / 8e-62 S-locus lectin protein kinase family protein (.1)
AT4G27300 204 / 9e-62 S-locus lectin protein kinase family protein (.1)
AT1G65800 199 / 7e-60 ARK2 receptor kinase 2 (.1)
AT4G21380 199 / 7e-60 ARK3 receptor kinase 3 (.1)
AT4G03230 194 / 1e-57 S-locus lectin protein kinase family protein (.1)
AT4G23150 184 / 5e-55 CRK7 cysteine-rich RLK (RECEPTOR-like protein kinase) 7 (.1)
AT4G23180 183 / 9e-55 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
AT4G23140 182 / 2e-54 RLK5, CRK6 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2)
AT1G11330 181 / 2e-53 S-locus lectin protein kinase family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G018050 313 / 1e-109 AT4G27300 310 / 2e-100 S-locus lectin protein kinase family protein (.1)
Potri.010G025700 309 / 9e-104 AT4G27290 576 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.010G018600 312 / 2e-102 AT4G27290 853 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.010G017450 310 / 9e-102 AT4G27290 847 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.010G018300 309 / 2e-101 AT4G27290 841 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.010G015400 305 / 3e-101 AT4G27290 683 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.010G025800 309 / 4e-101 AT4G27290 828 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.010G020300 306 / 6e-100 AT4G27290 832 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.010G018400 305 / 1e-99 AT4G27290 847 / 0.0 S-locus lectin protein kinase family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014811 243 / 3e-76 AT4G27290 808 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10038553 242 / 1e-75 AT4G27290 899 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10038552 237 / 9e-74 AT4G27290 879 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10014812 228 / 2e-70 AT4G27290 749 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10014813 228 / 2e-70 AT4G27290 805 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10033365 214 / 2e-65 AT4G21380 810 / 0.0 receptor kinase 3 (.1)
Lus10038554 213 / 8e-65 AT4G27290 776 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10037731 202 / 4e-62 AT4G27290 644 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10018405 200 / 5e-60 AT4G21380 952 / 0.0 receptor kinase 3 (.1)
Lus10007602 199 / 5e-60 AT1G65800 788 / 0.0 receptor kinase 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
CL0016 PF11883 DUF3403 Domain of unknown function (DUF3403)
Representative CDS sequence
>Potri.001G412377.1 pacid=42789185 polypeptide=Potri.001G412377.1.p locus=Potri.001G412377 ID=Potri.001G412377.1.v4.1 annot-version=v4.1
ATGAATCCAAAAATTTCAGACTTTGGCCTGGCTAGATGTTTTGGAGGAAATGAAACTGAAGCCAACACAAACAAAGTGGCTGGTACATATGGCTACATAT
CCCCAGAGTACGCAAATTATGGACTCTACTCGCTAAAATCTGATGTCTTCAGCTTTGGTGTATTGGTGCTAGAGATAGTAAGTGGGTACAGGAACAGAGG
ATTCTGCCACCCAGACCACCAACTCAACCTTCTTGGGCATGCTTGGAGACTGTTTAAAGAAGGCAGGCATGTGGAGCTGGTTGGGGGATTAATATTTGAA
ACTTGCAAATTATCTGAAGTTCTACGGTCGATTCACATAGGTCTATTATGTGTGCAAGAAAATGCAAAAGATAGGCCGAACATGTCACAGGTGGTTTTGA
TGCTGGGTAATGAAGATGAATTGCCTCAGCCTAAACATCCAGGTTTTTTTACTGGAAGGGATCTTATTGAAGCAAGCCATTCATTAAGTCAGAACAAACC
ATGTTCTGCAAACGGATGCTCGGTCTCCCTGTTAGAGGCACGGTAG
AA sequence
>Potri.001G412377.1 pacid=42789185 polypeptide=Potri.001G412377.1.p locus=Potri.001G412377 ID=Potri.001G412377.1.v4.1 annot-version=v4.1
MNPKISDFGLARCFGGNETEANTNKVAGTYGYISPEYANYGLYSLKSDVFSFGVLVLEIVSGYRNRGFCHPDHQLNLLGHAWRLFKEGRHVELVGGLIFE
TCKLSEVLRSIHIGLLCVQENAKDRPNMSQVVLMLGNEDELPQPKHPGFFTGRDLIEASHSLSQNKPCSANGCSVSLLEAR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G65790 ARK1 receptor kinase 1 (.1) Potri.001G412377 0 1
AT5G23960 ATTPS21 terpene synthase 21 (.1.2) Potri.019G023016 4.12 0.6997
AT1G53050 Protein kinase superfamily pro... Potri.005G086900 16.94 0.6139
AT1G52140 unknown protein Potri.003G049800 24.67 0.6313
Potri.012G017950 27.83 0.5524
Potri.018G056301 27.92 0.5846
AT5G66350 SHI SHORT INTERNODES, Lateral root... Potri.009G121600 31.22 0.6276
AT5G23570 SGS3, ATSGS3 SUPPRESSOR OF GENE SILENCING 3... Potri.003G188200 31.46 0.6043
AT4G27290 S-locus lectin protein kinase ... Potri.001G418100 31.62 0.6061
Potri.018G077983 31.74 0.5901
AT5G04930 ALA1 aminophospholipid ATPase 1 (.1... Potri.008G011461 35.49 0.5028

Potri.001G412377 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.