Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G20600 143 / 1e-42 NDR1 non race-specific disease resistance 1, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G20590 130 / 2e-37 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G20610 105 / 6e-28 non-race specific disease resistance protein, putative (.1) AT5G06320 51 / 8e-08 NHL3 NDR1/HIN1-like 3 (.1) AT3G11650 42 / 0.0001 NHL2 NDR1/HIN1-like 2 (.1) AT1G65690 40 / 0.0007 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT4G05220 40 / 0.0008 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G35980 39 / 0.001 NHL10, YLS9, ATNHL10 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G133900 [exp] 265 / 1e-90 AT3G20600 152 / 2e-46 non race-specific disease resistance 1, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.004G023400 [exp] 64 / 2e-12 AT3G20600 59 / 7e-11 non race-specific disease resistance 1, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.011G027400 [exp] 53 / 2e-08 AT4G05220 264 / 8e-90 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.004G023300 [exp] 49 / 3e-07 AT4G05220 276 / 7e-95 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.006G204300 [exp] 49 / 7e-07 AT2G35980 208 / 6e-68 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.016G071600 [exp] 47 / 2e-06 AT2G35980 205 / 9e-67 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043067 [exp] 171 / 1e-53 AT3G20600 154 / 7e-47 non race-specific disease resistance 1, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10011162 [exp] 165 / 3e-51 AT3G20600 139 / 3e-41 non race-specific disease resistance 1, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10021288 [exp] 47 / 4e-06 AT2G35980 237 / 2e-79 YELLOW-LEAF-SPECIFIC GENE 9, ARABIDOPSIS NDR1/HIN1-LIKE 10, Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10021286 [exp] 42 / 0.0001 AT3G52470 298 / 1e-103 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10026428 [exp] 42 / 0.0002 AT5G11890 209 / 7e-67 EMBRYO DEFECTIVE 3135, unknown protein Lus10018377 [exp] 42 / 0.0003 AT4G05200 489 / 4e-164 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10006754 [exp] 40 / 0.0004 AT4G05220 263 / 3e-89 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10016960 [exp] 40 / 0.0008 AT3G11660 295 / 1e-102 NDR1/HIN1-like 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G418000.1 pacid=42791091 polypeptide=Potri.001G418000.1.p locus=Potri.001G418000 ID=Potri.001G418000.1.v4.1 annot-version=v4.1 ATGCCGGATACCGGTGGAGGTGGCTGTTGTAGGTGCTGTTGTAGCTTCATATTCACTTTAGGGCTGACATCACTTTTTATGTGGCTCAGCTTACGTACTT CATCACCTGATTGTCTACTTAGACAATTTTATATTCCTCTTAACCAAACCTCAAACCTTACAAAACTTGAGTTTGAACTTAGGTTTAAAAACACCAACAA AGACAAGGGTGTGTACTATGATCCTATAAACGTTACATTTTTCGACAGTCCAAATAGGTCCCACTTTATTGGGAATTTTACTATACCAAAGTTTTATCAG GGGCATAAAAAGAAGGCTACAAAGAATTTTACCATTCCAAATATTGACCGGAAAGTGGTTGTCCAGGCGATTCCTGCAGTAAATGGGTCGACGACGACGT CTTTCAGGGTGGATTTGGCTACTTCAGTGAGGTACAAGATTCTTATGTTCAAAACTAAGAGGGATAAGATCAGGGTAGGGCTTGATTTTGATGTCAATGG TACCGTTGTTAAAGTCAACCGCAAAGATTTAAAGCTCAAGTCTAATGCAAATAAGATTAGGAGCTATTACGGGCAAATGGGAGTTCTTCTTGTTAATTTC TTGGTTTTAGGCTTGCTTGGTTTTTGGTGA
AA sequence Show only first row Show all	>Potri.001G418000.1 pacid=42791091 polypeptide=Potri.001G418000.1.p locus=Potri.001G418000 ID=Potri.001G418000.1.v4.1 annot-version=v4.1 MPDTGGGGCCRCCCSFIFTLGLTSLFMWLSLRTSSPDCLLRQFYIPLNQTSNLTKLEFELRFKNTNKDKGVYYDPINVTFFDSPNRSHFIGNFTIPKFYQ GHKKKATKNFTIPNIDRKVVVQAIPAVNGSTTTSFRVDLATSVRYKILMFKTKRDKIRVGLDFDVNGTVVKVNRKDLKLKSNANKIRSYYGQMGVLLVNF LVLGLLGFW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G20600		NDR1	non race-specific disease resi...		Potri.001G418000 [exp]	0	1
AT2G39840		TOPP4	type one serine/threonine prot...		Potri.019G018000 [exp]	4.47	0.7591
AT3G12410			Polynucleotidyl transferase, r...		Potri.006G031400 [exp]	5.19	0.7675
					Potri.014G013800 [exp]	9.48	0.8098
AT1G05805	bHLH	bHLH128	basic helix-loop-helix (bHLH) ...		Potri.002G231700 [exp]	12.44	0.8188
AT1G08450		AtCRT3, PSL1, E...	PRIORITY IN SWEET LIFE 1, EMS-...		Potri.019G055200 [exp]	12.84	0.7975
AT3G52430		PAD4, ATPAD4	ARABIDOPSIS PHYTOALEXIN DEFICI...		Potri.007G100600 [exp]	18.00	0.8137
AT5G24530		DMR6	DOWNY MILDEW RESISTANT 6, 2-ox...		Potri.015G002800 [exp]	21.44	0.7568
AT3G22530			unknown protein		Potri.008G154100 [exp]	22.27	0.8078
					Potri.016G028800 [exp]	22.95	0.7601
AT5G39990			Core-2/I-branching beta-1,6-N-...		Potri.009G003300 [exp]	24.97	0.7707

Compare expression of checked genes

Potri.001G418000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.