Plant FIBer expression Database

Potri.001G420900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G50900 234 / 8e-80 LTD, GDC1 LHCP translocation defect, Grana Deficient Chloroplast 1, Ankyrin repeat family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043055
[exp]
244 / 1e-83 AT1G50900 226 / 1e-76 LHCP translocation defect, Grana Deficient Chloroplast 1, Ankyrin repeat family protein (.1)
Lus10011151
[exp]
236 / 6e-81 AT1G50900 225 / 1e-76 LHCP translocation defect, Grana Deficient Chloroplast 1, Ankyrin repeat family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0465 Ank PF13857 Ank_5 Ankyrin repeats (many copies)
Representative CDS sequence
>Potri.001G420900.1 pacid=42793031 polypeptide=Potri.001G420900.1.p locus=Potri.001G420900 ID=Potri.001G420900.1.v4.1 annot-version=v4.1
ATGGCTTCAATCCTAAGTACAACCCATCTTACTCTCGCTTCCAATCCTCAAAGTTCTCAACCTTTTTTGCCTAAACTCAACTCTCAGTTTCTGGGTCTTC
AAAGTAATGTCGGTTGGTTAAGACCCTGTAGAATTGGACCCTCCAATGGGTCAAGAGCAAAGTGCTGGTTCAAATTTGGTAAAAATGGTGTTGATGCTGA
AGGTGCTGGCATTTATGGCAGCCAGACCCGTGATGACTTTGACAGAGATGATGTTGAGCAGTACTTTAACTACATGGGGATGCTTGCCGTTGAAGGTACA
TATGACAAGATGGAGGCTCTTCTGAGTCAAAACATTCATCCAGTGGACATCTTATTAATGCTGGCTGCTTCAGAAGGTGACAAGCCGAAGATTGAAGAGC
TTTTGAGAGCTGGAGCAGTTTACGATATCAAGGATGCAGATGGACGAACTGCACTTGATAGAGCCAATGAAGAAACCAAGGATTTCATCCTCGGTTTATC
TGTTCGCAAGGCGTGA
AA sequence
>Potri.001G420900.1 pacid=42793031 polypeptide=Potri.001G420900.1.p locus=Potri.001G420900 ID=Potri.001G420900.1.v4.1 annot-version=v4.1
MASILSTTHLTLASNPQSSQPFLPKLNSQFLGLQSNVGWLRPCRIGPSNGSRAKCWFKFGKNGVDAEGAGIYGSQTRDDFDRDDVEQYFNYMGMLAVEGT
YDKMEALLSQNIHPVDILLMLAASEGDKPKIEELLRAGAVYDIKDADGRTALDRANEETKDFILGLSVRKA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G50900 LTD, GDC1 LHCP translocation defect, Gra... Potri.001G420900
[exp]
0 1
AT1G50320 ATHX, ATX thioredoxin X (.1) Potri.007G074000
[exp]
1.41 0.9789
AT4G14890 FdC2 ferredoxin C 2, 2Fe-2S ferredo... Potri.008G153200
[exp]
2.23 0.9675
AT4G01310 Ribosomal L5P family protein (... Potri.002G154600
[exp]
4.24 0.9773
AT1G29070 Ribosomal protein L34 (.1) Potri.011G064800
[exp]
6.24 0.9737
AT1G48350 EMB3105 EMBRYO DEFECTIVE 3105, Ribosom... Potri.010G005000
[exp]
6.63 0.9632
AT5G46110 TPT, APE2 triose-phosphate ⁄ phosp... Potri.004G048900
[exp]
6.92 0.9593 Pt-APE2.2
AT4G15510 Photosystem II reaction center... Potri.005G010700
[exp]
6.92 0.9691
AT4G28660 PSB28 photosystem II reaction center... Potri.002G256400
[exp]
7.74 0.9662
AT4G01050 TROL thylakoid rhodanese-like (.1) Potri.002G169100
[exp]
8.12 0.9550
AT1G74070 Cyclophilin-like peptidyl-prol... Potri.012G058700
[exp]
9.21 0.9586

Potri.001G420900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.