Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G34520 134 / 1e-41 RPS14 mitochondrial ribosomal protein S14 (.1) ATCG00330 56 / 2e-11 ATCG00330.1, RPS14 chloroplast ribosomal protein S14 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G142336 [exp] 57 / 9e-12 ATCG00330 164 / 2e-54 chloroplast ribosomal protein S14 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017877 [exp] 156 / 5e-51 AT2G34520 131 / 2e-40 mitochondrial ribosomal protein S14 (.1) Lus10034657 [exp] 154 / 3e-50 AT2G34520 129 / 1e-39 mitochondrial ribosomal protein S14 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00253 [poplar] [flax] Ribosomal_S14 Ribosomal protein S14p/S29e
Representative CDS sequence Show only first row Show all	>Potri.001G424950.1 pacid=42792424 polypeptide=Potri.001G424950.1.p locus=Potri.001G424950 ID=Potri.001G424950.1.v4.1 annot-version=v4.1 ATGGAAGTACGCAAAGAGAATCGGAATATAAGAGATAACCACCGTCGCTTGCTCGCAGAGAAATTTGAATTGAAGCGAAACCTTTACAAGGCACTTGTTA GAGATCCCACACTTCCTCAGGAGATGCGTGAACTACATGCATATAAGCTGGCCAAGTTGCCAAGGAACAGTTCCTTTACACGAGTGAGAAACCGATGTGT TTTCACTGGTCGTCCTCGTGGTGTTTATCAGCTGTTTAGGATGTCTCGTCTTGTTTTCCGTTCATTGGCAAGCCAAGGTCTGTTGGAGGGCATAAGGAAG GCGTCCTGGTAA
AA sequence Show only first row Show all	>Potri.001G424950.1 pacid=42792424 polypeptide=Potri.001G424950.1.p locus=Potri.001G424950 ID=Potri.001G424950.1.v4.1 annot-version=v4.1 MEVRKENRNIRDNHRRLLAEKFELKRNLYKALVRDPTLPQEMRELHAYKLAKLPRNSSFTRVRNRCVFTGRPRGVYQLFRMSRLVFRSLASQGLLEGIRK ASW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G34520		RPS14	mitochondrial ribosomal protei...		Potri.001G424950 [exp]	0	1
AT4G09800		RPS18C	S18 ribosomal protein (.1)		Potri.005G196600 [exp]	1.00	0.8254	Pt-RPS18.2
AT5G60390			GTP binding Elongation factor ...		Potri.006G130900 [exp]	2.44	0.8153
AT2G18110			Translation elongation factor...		Potri.009G018600 [exp]	2.82	0.8093
AT3G61110		ARS27A	ribosomal protein S27 (.1)		Potri.001G069100 [exp]	4.24	0.8156	Pt-ARS27.2
AT4G30330			Small nuclear ribonucleoprotei...		Potri.018G096200 [exp]	6.48	0.7897
AT5G28640		ATGIF1, GIF1, A...	ARABIDOPSIS GRF1-INTERACTING F...		Potri.019G013100 [exp]	7.21	0.7391	Pt-GIF1.1
AT5G02960			Ribosomal protein S12/S23 fami...		Potri.010G217100 [exp]	8.83	0.7898	RPS23.2
AT3G02790	C2H2ZnF		zinc finger (C2H2 type) family...		Potri.013G086400 [exp]	13.41	0.7463
AT4G27585			SPFH/Band 7/PHB domain-contain...		Potri.012G005500 [exp]	13.49	0.6962
AT5G65260			RNA-binding (RRM/RBD/RNP motif...		Potri.001G311600 [exp]	14.28	0.7172

Compare expression of checked genes

Potri.001G424950 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.