Potri.001G425366 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G166832 144 / 1e-45 ND /
Potri.001G427901 100 / 1e-28 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.001G425366.1 pacid=42788945 polypeptide=Potri.001G425366.1.p locus=Potri.001G425366 ID=Potri.001G425366.1.v4.1 annot-version=v4.1
ATGATGAGCTGGTGCGGTTGGTGGTGTTGCTGCGACTGCTCTTCCTCCTCTCTGGTGTTACTGCGCTGCCTTTCCTCCTCGTCTGTGCAGTTGCTGGTGC
AGTTGGTGGTCTTGCCATTTTCGTCTACTGGCTTCTTGTTTCCTCCTCTTTCTATCTGCCTTCGGGTTCCTCTGGTGCTGGTGCTTGCTGAAGATGGAGG
TCGGGAAGGATATCCTGCTGTCATGTTACTGCTGTTGTTTGCTGCTTCAGGAGGAAGGATCCGGCTATTGTGCTGTTCTTGCTTATTGCTGCTCAAAGTG
GCTGAGGAATTGCAACTGGTGATGACCGCGCCCCTGCTGGTTCATGCTCCCAGTGCAGAGCAGAACACAGCTACTGCTGGCGACGGGGAAAAGATATAG
AA sequence
>Potri.001G425366.1 pacid=42788945 polypeptide=Potri.001G425366.1.p locus=Potri.001G425366 ID=Potri.001G425366.1.v4.1 annot-version=v4.1
MMSWCGWWCCCDCSSSSLVLLRCLSSSSVQLLVQLVVLPFSSTGFLFPPLSICLRVPLVLVLAEDGGREGYPAVMLLLLFAASGGRIRLLCCSCLLLLKV
AEELQLVMTAPLLVHAPSAEQNTATAGDGEKI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.001G425366 0 1
Potri.001G427901 1.00 0.9879
AT5G66330 Leucine-rich repeat (LRR) fami... Potri.005G234400 1.41 0.9491
Potri.006G166832 6.63 0.9305
AT3G49690 MYB ATMYB84, RAX3 REGULATOR OF AXILLARY MERISTEM... Potri.002G113700 7.00 0.9362
AT3G50700 C2H2ZnF ATIDD2 indeterminate(ID)-domain 2 (.1... Potri.002G208444 7.48 0.9353
AT2G43000 NAC ANAC042, JUB1, ... NAC domain containing protein ... Potri.002G057200 7.74 0.9377
AT1G74100 SOT16, ATSOT16,... CORONATINE INDUCED-7, ARABIDOP... Potri.011G048100 10.09 0.9408
AT1G74100 SOT16, ATSOT16,... CORONATINE INDUCED-7, ARABIDOP... Potri.011G048500 10.24 0.9381
AT4G14465 AT-hook AHL20 AT-hook motif nuclear-localize... Potri.013G044500 12.16 0.9394
AT5G54000 2-oxoglutarate (2OG) and Fe(II... Potri.018G121800 13.03 0.9308

Potri.001G425366 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.