Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G00330 136 / 8e-40 CRCK2 calmodulin-binding receptor-like cytoplasmic kinase 2 (.1) AT5G58940 90 / 3e-22 CRCK1 calmodulin-binding receptor-like cytoplasmic kinase 1 (.1) AT2G11520 77 / 1e-17 CRCK3 calmodulin-binding receptor-like cytoplasmic kinase 3 (.1) AT3G26940 45 / 1e-06 CDG1 CONSTITUTIVE DIFFERENTIAL GROWTH 1, Protein kinase superfamily protein (.1) AT3G46410 45 / 1e-06 Protein kinase superfamily protein (.1) AT5G07280 45 / 2e-06 EXS, EMS1 EXTRA SPOROGENOUS CELLS, EXCESS MICROSPOROCYTES1, Leucine-rich repeat transmembrane protein kinase (.1) AT5G60270 45 / 2e-06 Concanavalin A-like lectin protein kinase family protein (.1) AT2G05940 45 / 2e-06 RIPK RPM1-induced protein kinase, Protein kinase superfamily protein (.1) AT1G61590 45 / 3e-06 Protein kinase superfamily protein (.1) AT1G70130 45 / 3e-06 Concanavalin A-like lectin protein kinase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G161600 [exp] 228 / 6e-75 AT4G00330 479 / 2e-168 calmodulin-binding receptor-like cytoplasmic kinase 2 (.1) Potri.014G087200 [exp] 192 / 7e-61 AT4G00330 488 / 7e-172 calmodulin-binding receptor-like cytoplasmic kinase 2 (.1) Potri.009G041900 [exp] 115 / 2e-31 AT5G58940 412 / 3e-141 calmodulin-binding receptor-like cytoplasmic kinase 1 (.1) Potri.018G124600 [exp] 83 / 7e-20 AT2G11520 502 / 6e-175 calmodulin-binding receptor-like cytoplasmic kinase 3 (.1) Potri.006G064200 [exp] 80 / 1e-18 AT2G11520 508 / 2e-177 calmodulin-binding receptor-like cytoplasmic kinase 3 (.1) Potri.016G101000 [exp] 50 / 4e-08 AT3G55550 704 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G262866 [exp] 48 / 2e-07 AT5G10530 384 / 1e-124 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G283200 [exp] 48 / 2e-07 AT5G10530 382 / 8e-125 Concanavalin A-like lectin protein kinase family protein (.1) Potri.001G283700 [exp] 47 / 3e-07 AT5G10530 497 / 7e-168 Concanavalin A-like lectin protein kinase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036376 [exp] 144 / 9e-43 AT4G00330 474 / 1e-166 calmodulin-binding receptor-like cytoplasmic kinase 2 (.1) Lus10014760 [exp] 145 / 2e-41 AT4G00350 703 / 0.0 MATE efflux family protein (.1) Lus10018828 [exp] 134 / 7e-39 AT4G00330 471 / 2e-165 calmodulin-binding receptor-like cytoplasmic kinase 2 (.1) Lus10017787 [exp] 135 / 2e-38 AT4G00330 471 / 1e-163 calmodulin-binding receptor-like cytoplasmic kinase 2 (.1) Lus10040704 [exp] 110 / 7e-30 AT5G58940 418 / 3e-143 calmodulin-binding receptor-like cytoplasmic kinase 1 (.1) Lus10018203 [exp] 107 / 2e-28 AT3G46980 689 / 0.0 phosphate transporter 4;3 (.1.2.3) Lus10018913 [exp] 77 / 1e-17 AT2G11520 520 / 0.0 calmodulin-binding receptor-like cytoplasmic kinase 3 (.1) Lus10041796 [exp] 77 / 1e-17 AT2G11520 498 / 2e-175 calmodulin-binding receptor-like cytoplasmic kinase 3 (.1) Lus10028347 [exp] 77 / 2e-17 AT2G11520 435 / 3e-149 calmodulin-binding receptor-like cytoplasmic kinase 3 (.1) Lus10028613 [exp] 76 / 3e-17 AT2G11520 540 / 0.0 calmodulin-binding receptor-like cytoplasmic kinase 3 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G434200.1 pacid=42791691 polypeptide=Potri.001G434200.1.p locus=Potri.001G434200 ID=Potri.001G434200.1.v4.1 annot-version=v4.1 ATGACAGGTAGGCGTCCTATTGAACCGAAAAGGGAAATAAAGGAACGATTAACTGCAAAATGGGCAATAAAGAAGTTTGCAGAAGGTAATGCCATTGTGA TCTTGGACCCGAAGCTAGAGCGAACTGCTGCAAATAACTTGGCCCTAGAAAAGATTCTGGAACTAGCATTGCAATGTTTGGCTCCTGGCAGACAGAGCAG GCCGAGCATGAGGAAATGCGCAGAGGTTCTTTGGAGCATTCGTAAGGATTACAAGGAACAATCAACCTCAGATTTTTGTTATCTTATTTCTTCTAAATCA CAGGGGAGTTTTTCAGTTATAACAGAAGAATAA
AA sequence Show only first row Show all	>Potri.001G434200.1 pacid=42791691 polypeptide=Potri.001G434200.1.p locus=Potri.001G434200 ID=Potri.001G434200.1.v4.1 annot-version=v4.1 MTGRRPIEPKREIKERLTAKWAIKKFAEGNAIVILDPKLERTAANNLALEKILELALQCLAPGRQSRPSMRKCAEVLWSIRKDYKEQSTSDFCYLISSKS QGSFSVITEE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G00330		CRCK2	calmodulin-binding receptor-li...		Potri.001G434200 [exp]	0	1
					Potri.004G088550 [exp]	5.83	0.6906
					Potri.002G003050 [exp]	14.10	0.6917
					Potri.014G038500 [exp]	15.58	0.6576
AT2G34400			Pentatricopeptide repeat (PPR-...		Potri.003G041650 [exp]	22.24	0.5928
AT3G29400		ATEXO70E1	exocyst subunit exo70 family p...		Potri.017G093650 [exp]	23.40	0.6813
AT1G64295			F-box associated ubiquitinatio...		Potri.010G224400 [exp]	23.45	0.6770
					Potri.010G200150 [exp]	25.21	0.6675
AT5G19875			unknown protein		Potri.003G216100 [exp]	37.30	0.6396
AT2G29420		GST25, ATGSTU7	GLUTATHIONE S-TRANSFERASE 25, ...		Potri.010G060900 [exp]	39.33	0.6593
AT1G78380		GST8, ATGSTU19	GLUTATHIONE TRANSFERASE 8, A. ...		Potri.011G113125 [exp]	42.66	0.6394

Compare expression of checked genes

Potri.001G434200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.