Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38130 299 / 6e-105 ATMAK3 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2) AT5G11340 61 / 1e-11 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G429200 [exp] 395 / 4e-143 AT2G38130 299 / 6e-105 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2) Potri.001G432400 [exp] 356 / 1e-127 AT2G38130 296 / 4e-104 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2) Potri.011G139300 [exp] 356 / 4e-127 AT2G38130 294 / 1e-102 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2) Potri.001G425800 [exp] 254 / 1e-87 AT2G38130 207 / 2e-69 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2) Potri.001G433800 [exp] 133 / 3e-40 AT2G38130 117 / 3e-34 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2) Potri.006G248900 [exp] 62 / 3e-12 AT5G11340 280 / 3e-98 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Potri.018G032400 [exp] 59 / 3e-11 AT5G11340 270 / 4e-94 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Potri.006G142100 [exp] 41 / 0.0002 AT2G06025 347 / 1e-120 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012579 [exp] 315 / 5e-111 AT2G38130 286 / 7e-100 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2) Lus10041514 [exp] 315 / 6e-111 AT2G38130 287 / 3e-100 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2) Lus10008088 [exp] 60 / 5e-11 AT5G11340 249 / 2e-85 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Lus10013120 [exp] 52 / 2e-08 AT5G11340 256 / 8e-89 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Lus10037996 [exp] 41 / 0.0002 AT2G39000 335 / 2e-115 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3) Lus10009229 [exp] 40 / 0.0005 AT2G39000 320 / 5e-112 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3) Lus10042595 [exp] 39 / 0.001 AT1G03150 348 / 6e-125 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0257 [poplar] [flax] Acetyltrans PF00583 [poplar] [flax] Acetyltransf_1 Acetyltransferase (GNAT) family
Representative CDS sequence Show only first row Show all	>Potri.001G435300.1 pacid=42791982 polypeptide=Potri.001G435300.1.p locus=Potri.001G435300 ID=Potri.001G435300.1.v4.1 annot-version=v4.1 ATGGACGAAGTTCAAGAAAGAGAGAAAAAAGAAGAATTCGATGCATCAGAGATTGAATACGTTAGCTATGGTGGCGAGCATCACCTACCATTAATCATGA ATCTTGTCGATCAAGAACTTAGTGAGCCTTACTCCATCTTCACCTACCGTTACTTTGTTTATCTTTGGCCACAACTTTCTTTCTTGGCGTTTCACAAAGG CAAATGTGTAGGGACTGTTGTTTGTAAGATGGGGGATCATCGGAATTCAACTTTTAGAGGTTACATTGCTATGTTAGTTGTCATCAAACCTTATCGAGGA AGAGGCATTGCTACTGAACTTGTTACCAGATCTATTCAAGTGATGATGGAATCTGGATGCGAAGAGGTAACATTGGAAGCAGAAGTTACAAATAAAGGAG CACTTGCACTATATGGCCGTCTTGGTTTTATTAGAGCAAAACGACTCTTTCACTATTACTTGAATGGAGTTGATGCCTTTCGTCTGAAGCTGCTATTCCC CCAGCCAGAGTTATACCCCTCTTTGCCTATGATGGCTGATAGAGACGATACACACGAGCATGATGATTGCTAG
AA sequence Show only first row Show all	>Potri.001G435300.1 pacid=42791982 polypeptide=Potri.001G435300.1.p locus=Potri.001G435300 ID=Potri.001G435300.1.v4.1 annot-version=v4.1 MDEVQEREKKEEFDASEIEYVSYGGEHHLPLIMNLVDQELSEPYSIFTYRYFVYLWPQLSFLAFHKGKCVGTVVCKMGDHRNSTFRGYIAMLVVIKPYRG RGIATELVTRSIQVMMESGCEEVTLEAEVTNKGALALYGRLGFIRAKRLFHYYLNGVDAFRLKLLFPQPELYPSLPMMADRDDTHEHDDC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G38130		ATMAK3	Acyl-CoA N-acyltransferases (N...		Potri.001G435300 [exp]	0	1
AT3G57710			Protein kinase superfamily pro...		Potri.013G020100 [exp]	1.41	0.8427
AT3G16890		PPR40	pentatricopeptide (PPR) domain...		Potri.010G141201 [exp]	2.44	0.8248
AT1G01490			Heavy metal transport/detoxifi...		Potri.017G145516 [exp]	6.32	0.7918
AT2G38130		ATMAK3	Acyl-CoA N-acyltransferases (N...		Potri.001G429200 [exp]	6.92	0.7435
AT4G14110		FUS7, EMB143, C...	FUSCA 7, EMBRYO DEFECTIVE 143,...		Potri.003G022001 [exp]	19.44	0.7526
AT1G08460		HDA8, HDA08, AT...	histone deacetylase 8 (.1)		Potri.009G020500 [exp]	24.12	0.6829
AT3G03980			NAD(P)-binding Rossmann-fold s...		Potri.019G033600 [exp]	29.24	0.7088
AT1G55880			Pyridoxal-5'-phosphate-depende...		Potri.001G367000 [exp]	31.93	0.6907
AT2G02370			SNARE associated Golgi protein...		Potri.003G151800 [exp]	34.13	0.6219
AT1G54850			HSP20-like chaperones superfam...		Potri.013G024900 [exp]	34.69	0.7831

Compare expression of checked genes

Potri.001G435300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.