Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G78320 40 / 0.0001 ATGSTU23 glutathione S-transferase TAU 23 (.1) AT1G78380 0 / 1 GST8, ATGSTU19 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G140700 [exp] 66 / 4e-14 AT1G78380 287 / 3e-99 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) Potri.011G140600 [exp] 41 / 5e-05 AT1G78380 252 / 2e-85 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) Potri.011G140501 [exp] 39 / 0.0001 AT1G17180 0 / 1 glutathione S-transferase TAU 25 (.1) Potri.005G037801 [exp] 39 / 0.0002 AT1G78340 197 / 7e-65 glutathione S-transferase TAU 22 (.1) Potri.001G436500 [exp] 0 / 1 AT1G78380 303 / 2e-105 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) Potri.011G140750 [exp] 0 / 1 AT1G17170 122 / 2e-36 Arabidopsis thaliana Glutathione S-transferase \(class tau\) 24, glutathione S-transferase TAU 24 (.1) Potri.001G437200 [exp] 0 / 1 AT1G78380 308 / 2e-107 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) Potri.001G437100 [exp] 0 / 1 AT1G78380 304 / 7e-106 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) Potri.011G140800 [exp] 0 / 1 AT1G78380 318 / 1e-111 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042468 [exp] 42 / 2e-05 AT1G78380 306 / 6e-107 GLUTATHIONE TRANSFERASE 8, A. THALIANA GLUTATHIONE S-TRANSFERASE TAU 19, glutathione S-transferase TAU 19 (.1) Lus10026199 [exp] 0 / 1 AT1G17160 496 / 8e-173 pfkB-like carbohydrate kinase family protein (.1.2) Lus10021102 [exp] 0 / 1 AT3G09270 245 / 2e-82 glutathione S-transferase TAU 8 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.001G436433.1 pacid=42789629 polypeptide=Potri.001G436433.1.p locus=Potri.001G436433 ID=Potri.001G436433.1.v4.1 annot-version=v4.1 ATGAGAGTAAGAATTGCACTGACAGAGAAGTATAAGTACAGTGAACAGGACTTGGGCAACGAAAGTGATTTGCTTCTGCGGATGAACCAGTTTACAAGAA GATTCCAGTTCTCATCCACAATGAAAAACATGCTTTTGAATCCCCTATTATTCAATATATTGATGAAGTGTGGAAGGACAAGGCTCCTTCGCTACCTTCT GATCCATATGAAAGAGCCCATTCCATGTTCTCGGCTGATTTTTCTGATCCTTGTAAAATTTATGTTTTCTATTACTTTTTGGTTGCACTTGTCTGATATC TATGCATGGGTGCTGGGATTTTATCAGTTTATTTGTATCTGTTGA
AA sequence Show only first row Show all	>Potri.001G436433.1 pacid=42789629 polypeptide=Potri.001G436433.1.p locus=Potri.001G436433 ID=Potri.001G436433.1.v4.1 annot-version=v4.1 MRVRIALTEKYKYSEQDLGNESDLLLRMNQFTRRFQFSSTMKNMLLNPLLFNILMKCGRTRLLRYLLIHMKEPIPCSRLIFLILVKFMFSITFWLHLSDI YAWVLGFYQFICIC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G17170		ATGSTU24	Arabidopsis thaliana Glutathio...		Potri.001G436433 [exp]	0	1
					Potri.003G104800 [exp]	2.44	0.9531
AT5G04700			Ankyrin repeat family protein ...		Potri.008G023101 [exp]	4.47	0.9378
AT2G32580			Protein of unknown function (D...		Potri.004G006500 [exp]	7.48	0.9301
AT3G24060			Plant self-incompatibility pro...		Potri.003G175200 [exp]	9.32	0.9076
AT5G35080			unknown protein		Potri.018G118200 [exp]	11.18	0.9096
AT5G05800			unknown protein		Potri.008G196901 [exp]	11.22	0.9295
					Potri.006G062150 [exp]	11.40	0.9268
AT4G23930			Late embryogenesis abundant (L...		Potri.001G090400 [exp]	11.61	0.8973
AT5G54370			Late embryogenesis abundant (L...		Potri.001G405650 [exp]	13.49	0.9244
AT1G30800			Fasciclin-like arabinogalactan...		Potri.011G155150 [exp]	13.56	0.8964

Compare expression of checked genes

Potri.001G436433 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.