Potri.001G439800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G32210 40 / 9e-06 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G439900 121 / 9e-38 ND /
Potri.015G120800 37 / 0.0001 AT2G32210 39 / 3e-05 unknown protein
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.001G439800.1 pacid=42791518 polypeptide=Potri.001G439800.1.p locus=Potri.001G439800 ID=Potri.001G439800.1.v4.1 annot-version=v4.1
ATGGCTCAAACCGATCAACAACAAGCTCCAGAAATATATGAACCGGCTTGTCAGGTGAATCCACCACCTGCACCACCGATAGGGTACCCTCAAGGTCACT
ATGTTGCACCACCACCAATTGGTTATCCCACTATGGATGATTCAGGTTACCCTTCCAAGCATACTCCAGAGACCAAAATGAGAGGATCCATTGAAATTCA
GTGTTGCTGCTTTGTCTGGAGCAAGTCGTCCTAG
AA sequence
>Potri.001G439800.1 pacid=42791518 polypeptide=Potri.001G439800.1.p locus=Potri.001G439800 ID=Potri.001G439800.1.v4.1 annot-version=v4.1
MAQTDQQQAPEIYEPACQVNPPPAPPIGYPQGHYVAPPPIGYPTMDDSGYPSKHTPETKMRGSIEIQCCCFVWSKSS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G32210 unknown protein Potri.001G439800 0 1
AT4G14640 CAM8, AtCML8 calmodulin-like 8, calmodulin ... Potri.005G052800 2.64 0.9643 ACCAL.4
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Potri.008G212500 2.82 0.9730
Potri.008G212400 3.00 0.9740
AT5G06740 Concanavalin A-like lectin pro... Potri.006G193000 3.16 0.9666
AT2G45040 Matrixin family protein (.1) Potri.001G157500 5.65 0.9563 Pt-MMP.15
AT1G31130 unknown protein Potri.002G074200 6.63 0.9591
AT2G42360 RING/U-box superfamily protein... Potri.019G091400 7.14 0.9559
AT1G19020 unknown protein Potri.012G075800 8.30 0.9500
AT2G26560 PLP2, PLAIIA, P... PATATIN-LIKE PROTEIN 2, phosph... Potri.017G134001 8.48 0.9651
AT5G12340 unknown protein Potri.001G276400 8.48 0.9609

Potri.001G439800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.