Potri.001G439900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G32210 37 / 0.0003 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G439800 121 / 1e-37 AT2G32210 39 / 1e-05 unknown protein
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.001G439900.1 pacid=42790674 polypeptide=Potri.001G439900.1.p locus=Potri.001G439900 ID=Potri.001G439900.1.v4.1 annot-version=v4.1
ATGGCTCAAACCAATCAAAAACAAGCTCCAGAGATATATGAACCGGCTTGTCAGGTGAATCCACCACCTGCACCACCGATAGGGTACCCTCAAGGTCACT
ATGTTGCACCACCACCAATTGATTATCCCACTATGGATGCACCACCGATAGGGTACCCTCAAGGTCACTATGTTGCACCACCACCAATTGGTCATCCCAC
TATGGATGATTCAGGTTACCCTTCCCAGCATACTCCAGAGACCAAAATGACAGGATCCATTGAAATTCAGTGTTGCTGCTTTGTCTGGAGGAAGTCCTAG
AA sequence
>Potri.001G439900.1 pacid=42790674 polypeptide=Potri.001G439900.1.p locus=Potri.001G439900 ID=Potri.001G439900.1.v4.1 annot-version=v4.1
MAQTNQKQAPEIYEPACQVNPPPAPPIGYPQGHYVAPPPIDYPTMDAPPIGYPQGHYVAPPPIGHPTMDDSGYPSQHTPETKMTGSIEIQCCCFVWRKS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.001G439900 0 1
AT3G27890 NQR NADPH:quinone oxidoreductase (... Potri.003G195900 1.41 0.9998 NQR.1
AT2G15220 Plant basic secretory protein ... Potri.009G094500 3.00 0.9998
AT5G06740 Concanavalin A-like lectin pro... Potri.016G045000 3.46 0.9997
Potri.006G261111 5.65 0.9996
AT1G29670 GDSL-like Lipase/Acylhydrolase... Potri.003G213700 7.41 0.9997
AT2G15220 Plant basic secretory protein ... Potri.009G094600 10.09 0.9989
AT5G11210 ATGLR2.5 ARABIDOPSIS THALIANA GLU, glut... Potri.001G375133 10.24 0.9994
Potri.003G010532 10.39 0.9996
AT2G29120 ATGLR2.7 GLUTAMATE RECEPTOR 2.7, gluta... Potri.001G375100 10.72 0.9994
AT1G19250 FMO1 flavin-dependent monooxygenase... Potri.001G335900 11.22 0.9996

Potri.001G439900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.