Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	LSD1.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G20380 195 / 3e-64 LSD1 LESION SIMULATING DISEASE, LSD1 zinc finger family protein (.1.2.3.4.5.6.7.8) AT1G32540 146 / 5e-45 LOL1 lsd one like 1 (.1.2.3) AT4G21610 80 / 3e-19 LOL2 lsd one like 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G154800 [exp] 287 / 1e-100 AT4G20380 205 / 5e-68 LESION SIMULATING DISEASE, LSD1 zinc finger family protein (.1.2.3.4.5.6.7.8) Potri.003G090300 [exp] 144 / 1e-44 AT1G32540 194 / 1e-64 lsd one like 1 (.1.2.3) Potri.001G143900 [exp] 144 / 3e-44 AT1G32540 189 / 9e-63 lsd one like 1 (.1.2.3) Potri.004G043100 [exp] 74 / 2e-17 AT4G21610 131 / 7e-40 lsd one like 2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008066 [exp] 261 / 9e-90 AT4G20380 212 / 6e-70 LESION SIMULATING DISEASE, LSD1 zinc finger family protein (.1.2.3.4.5.6.7.8) Lus10023392 [exp] 241 / 3e-82 AT4G20380 210 / 6e-70 LESION SIMULATING DISEASE, LSD1 zinc finger family protein (.1.2.3.4.5.6.7.8) Lus10038409 [exp] 208 / 4e-67 AT1G32540 179 / 2e-55 lsd one like 1 (.1.2.3) Lus10000782 [exp] 194 / 2e-64 AT4G20380 160 / 4e-51 LESION SIMULATING DISEASE, LSD1 zinc finger family protein (.1.2.3.4.5.6.7.8) Lus10040081 [exp] 151 / 4e-46 AT1G32540 227 / 3e-76 lsd one like 1 (.1.2.3) Lus10035361 [exp] 146 / 2e-45 AT1G32540 233 / 5e-80 lsd one like 1 (.1.2.3) Lus10030969 [exp] 146 / 3e-45 AT1G32540 236 / 5e-81 lsd one like 1 (.1.2.3) Lus10020766 [exp] 81 / 2e-19 AT4G21610 133 / 3e-40 lsd one like 2 (.1) Lus10028157 [exp] 39 / 0.001 AT1G02170 540 / 0.0 LSD ONE LIKE 3, ARABIDOPSIS THALIANA METACASPASE 1B, metacaspase 1b, ARABIDOPSIS THALIANA METACASPASE 1, metacaspase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06943 [poplar] [flax] zf-LSD1 LSD1 zinc finger
Representative CDS sequence Show only first row Show all	>Potri.001G442400.2 pacid=42790115 polypeptide=Potri.001G442400.2.p locus=Potri.001G442400 ID=Potri.001G442400.2.v4.1 annot-version=v4.1 ATGCAAAGCCAGGTGGTGTGTAGAGGGTGTGCAAGTGTATTGTTATATCCAAGTGGAGCTTCTAACGTTTGTTGTGCTTTATGTAGTACTGTTACTTCCA TTCCTTCTCCTGGGATGGACATGGCTCAACTCATATGTAGAGGTTGCAGGTCATTGCTAATGTATCCACATGGGGCAACAACTGTGAGATGCTCCTGCTG CCACGTAGTGAACATTGCACCAGGATATAACCAGGCCGCTCATGTCAACTGTGGGAACTGCCGGACTGCTCTTATGTATCCAAATGGATCTCCATCTGTC AAGTGTCCTGTCTGTCACTATGTTACTAATGTTAGTATGGCTAACATGAGAATTCCGCTTCCAGCAAACAGACCTAATGGTATAGGTGGAACAGCACCAT CTACTTCAATGCCATTGCCCCATTCTCAGACTCAAACTGTCGTTGTGGAAAACCCCATGTCTGTTGATGAAAGTGGCAAATTGGTCAGCAATGTTGTTGT TGGTGTCACTACAGAAAAAAAATAA
AA sequence Show only first row Show all	>Potri.001G442400.2 pacid=42790115 polypeptide=Potri.001G442400.2.p locus=Potri.001G442400 ID=Potri.001G442400.2.v4.1 annot-version=v4.1 MQSQVVCRGCASVLLYPSGASNVCCALCSTVTSIPSPGMDMAQLICRGCRSLLMYPHGATTVRCSCCHVVNIAPGYNQAAHVNCGNCRTALMYPNGSPSV KCPVCHYVTNVSMANMRIPLPANRPNGIGGTAPSTSMPLPHSQTQTVVVENPMSVDESGKLVSNVVVGVTTEKK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G20380		LSD1	LESION SIMULATING DISEASE, LSD...		Potri.001G442400 [exp]	0	1	LSD1.1
AT5G37290			ARM repeat superfamily protein...		Potri.001G225300 [exp]	3.46	0.8602
AT2G39445			Phosphatidylinositol N-acetylg...		Potri.002G134800 [exp]	10.95	0.8006
AT4G36720		HVA22K	HVA22-like protein K (.1)		Potri.009G113400 [exp]	10.95	0.7709
AT1G54210		ATATG12, APG12,...	AUTOPHAGY 12 A, AUTOPHAGY 12, ...		Potri.001G169700 [exp]	12.36	0.7805
AT4G33690			unknown protein		Potri.001G287900 [exp]	12.80	0.7543
AT1G18720			Protein of unknown function (D...		Potri.010G166500 [exp]	14.42	0.7804
AT3G51130			unknown protein		Potri.005G117200 [exp]	16.43	0.7799
AT5G17610			unknown protein		Potri.013G073100 [exp]	21.21	0.8121
AT3G16175			Thioesterase superfamily prote...		Potri.003G051900 [exp]	23.34	0.7397
AT2G29700		ATPH1	pleckstrin homologue 1 (.1)		Potri.009G044500 [exp]	24.18	0.7671	ATPH1.1

Compare expression of checked genes

Potri.001G442400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.