Potri.001G444300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G34050 65 / 1e-12 Ankyrin repeat family protein (.1)
AT5G51160 61 / 3e-11 Ankyrin repeat family protein (.1)
AT2G24600 60 / 8e-11 Ankyrin repeat family protein (.1.2.3.4)
AT5G50140 60 / 9e-11 Ankyrin repeat family protein (.1)
AT5G54710 59 / 2e-10 Ankyrin repeat family protein (.1)
AT1G10340 55 / 5e-09 Ankyrin repeat family protein (.1.2)
AT5G54700 52 / 4e-08 Ankyrin repeat family protein (.1)
AT3G13950 41 / 0.0001 unknown protein
AT4G03500 40 / 0.0006 Ankyrin repeat family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G443600 323 / 8e-115 AT1G34050 62 / 9e-12 Ankyrin repeat family protein (.1)
Potri.014G050532 289 / 4e-101 AT2G24600 69 / 1e-13 Ankyrin repeat family protein (.1.2.3.4)
Potri.014G050800 187 / 9e-61 AT5G51160 87 / 5e-20 Ankyrin repeat family protein (.1)
Potri.014G050900 171 / 4e-54 AT5G51160 81 / 9e-18 Ankyrin repeat family protein (.1)
Potri.014G050700 124 / 7e-36 AT5G51160 56 / 2e-09 Ankyrin repeat family protein (.1)
Potri.014G050600 117 / 1e-33 AT5G51160 67 / 3e-13 Ankyrin repeat family protein (.1)
Potri.015G111300 68 / 1e-13 AT5G51160 338 / 2e-112 Ankyrin repeat family protein (.1)
Potri.001G187600 67 / 4e-13 AT5G50140 280 / 3e-86 Ankyrin repeat family protein (.1)
Potri.012G113800 65 / 1e-12 AT5G51160 351 / 1e-117 Ankyrin repeat family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041537 89 / 5e-21 AT5G51160 350 / 2e-117 Ankyrin repeat family protein (.1)
Lus10024844 60 / 1e-10 AT1G34050 353 / 4e-114 Ankyrin repeat family protein (.1)
Lus10037894 59 / 3e-10 AT1G10340 298 / 3e-93 Ankyrin repeat family protein (.1.2)
Lus10038608 59 / 3e-10 AT1G10340 168 / 2e-47 Ankyrin repeat family protein (.1.2)
Lus10018757 56 / 3e-09 AT1G34050 298 / 3e-93 Ankyrin repeat family protein (.1)
Lus10024845 55 / 3e-09 AT2G24600 193 / 5e-58 Ankyrin repeat family protein (.1.2.3.4)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF13962 PGG Domain of unknown function
Representative CDS sequence
>Potri.001G444300.1 pacid=42788808 polypeptide=Potri.001G444300.1.p locus=Potri.001G444300 ID=Potri.001G444300.1.v4.1 annot-version=v4.1
ATGTCTCAGCCTAAAAAAAACAATACTAAAAGAAGTGCTAGCGGGTTCAAGAAATTTCAGTATGATGAAGTGAGAGACTCACCAAGCGATGCTAGAAATG
TTTTGCTAGTAGTTGTGGCCTTGATTGCAGCAGTGACTTTCCAGGCCGGGGTGAACCCTCCTGGAGGGGTCTGGCAAGAAGGAGATCGTGTAGGAAGAGC
AATTTATGCATCTCAAAAGCGTGCTTTCTATGTTTTCTTGATATCAAACACTTTGGCTCTCTCCACTTGTATACTTGTCATTACATCTCTCACTTACAGG
TTCCCTTTCCATCTTGAAATATGGGCTGCTACAGCTTCAATTATGATAACCTATGCATCTGCGGTTTTTGCTGTTACTCCTAATGAATCTGTGCGTTTTC
GCTATCTTTTGATTGCAGCTTCAGTGCCTTTTGTGATGAGGTGTTTTGGTTATTTCTTCAAGAAGTACTGTATGAGTGAGAATGAGAGTCAAATAGGAGG
TCAGGAAGAAGTAGAAAAAAAGGATGGGCAAGCAGGTCAACAAGTGTAG
AA sequence
>Potri.001G444300.1 pacid=42788808 polypeptide=Potri.001G444300.1.p locus=Potri.001G444300 ID=Potri.001G444300.1.v4.1 annot-version=v4.1
MSQPKKNNTKRSASGFKKFQYDEVRDSPSDARNVLLVVVALIAAVTFQAGVNPPGGVWQEGDRVGRAIYASQKRAFYVFLISNTLALSTCILVITSLTYR
FPFHLEIWAATASIMITYASAVFAVTPNESVRFRYLLIAASVPFVMRCFGYFFKKYCMSENESQIGGQEEVEKKDGQAGQQV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G34050 Ankyrin repeat family protein ... Potri.001G444300 0 1
AT1G34050 Ankyrin repeat family protein ... Potri.001G443600 1.00 0.9822
AT4G03500 Ankyrin repeat family protein ... Potri.019G107400 2.00 0.9674
AT2G24600 Ankyrin repeat family protein ... Potri.014G050532 6.00 0.9575
Potri.002G190900 11.83 0.9146
AT4G13440 Calcium-binding EF-hand family... Potri.019G026900 12.24 0.9427
AT4G13440 Calcium-binding EF-hand family... Potri.019G027100 13.41 0.9421
AT4G13440 Calcium-binding EF-hand family... Potri.019G027000 14.73 0.9386
AT4G13440 Calcium-binding EF-hand family... Potri.019G028800 16.49 0.9280
AT1G71865 unknown protein Potri.019G086700 18.43 0.8125
AT5G10770 Eukaryotic aspartyl protease f... Potri.018G014600 19.18 0.8842

Potri.001G444300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.