Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G10500 406 / 3e-142 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10490 392 / 2e-136 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G24530 311 / 1e-104 DMR6 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G36690 249 / 2e-80 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G44800 229 / 1e-72 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G60290 220 / 5e-69 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G08640 201 / 4e-62 ATFLS1, FLS flavonol synthase 1 (.1.2) AT5G05600 201 / 1e-61 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G38240 200 / 2e-61 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G77330 194 / 9e-60 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G150100 [exp] 461 / 8e-164 AT4G10490 501 / 2e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451900 [exp] 459 / 9e-163 AT4G10490 498 / 3e-178 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451700 [exp] 444 / 4e-157 AT4G10500 451 / 6e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.014G106700 [exp] 426 / 6e-150 AT4G10490 468 / 2e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G150200 [exp] 387 / 1e-134 AT4G10500 323 / 1e-109 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451500 [exp] 379 / 3e-131 AT4G10500 325 / 2e-110 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G151000 [exp] 375 / 6e-130 AT4G10500 287 / 2e-95 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451300 [exp] 374 / 2e-129 AT4G10500 326 / 1e-110 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G150300 [exp] 367 / 1e-126 AT4G10500 327 / 4e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030185 [exp] 384 / 4e-133 AT4G10490 442 / 3e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10032930 [exp] 308 / 1e-103 AT5G24530 504 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10015573 [exp] 304 / 7e-102 AT5G24530 510 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10035782 [exp] 248 / 1e-79 AT5G24530 258 / 4e-84 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10014398 [exp] 233 / 9e-74 AT2G36690 482 / 4e-171 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10023890 [exp] 228 / 1e-71 AT2G36690 486 / 5e-173 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10024882 [exp] 213 / 2e-66 AT5G24530 271 / 2e-89 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10037796 [exp] 213 / 4e-66 AT1G06620 442 / 4e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10032502 [exp] 211 / 3e-65 AT5G07480 396 / 3e-138 KAR-UP oxidoreductase 1 (.1) Lus10000711 [exp] 205 / 2e-63 AT5G24530 263 / 4e-86 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.001G451600.1 pacid=42792585 polypeptide=Potri.001G451600.1.p locus=Potri.001G451600 ID=Potri.001G451600.1.v4.1 annot-version=v4.1 ATGATGTACTCTAATGAGGTGCTATCATCCCTTTTAATCTCTGACGTGAAAGATGTTCCATCCAACAACATTAATCCTATCTTTGATCTACCAAAACTCT CAGAGCTTGATGCATCAGATGACTCCATTCCTCTCATTGATCTTGATGGCCTCAACGGTCCAAACCGGTCTCTCATTATCAATCAGATTGGCCAAGCATG CGAAGAATATGGTTTCTTCATGGTGAAGAATCATGGAATTCCAGAGGCAACGATTAACAACATACAAAGTACAGCAATGAAATTCTTCAAGCTGCCAAAT GAGGAAAGGTTGAAATTTCAATCAATTGACCCTACCAAGACCATCAGACTGACTACTGGTTTTAACAACAAGAATCAGAAAGTCTTTGTCTGGAGAGAAT CCTTGAAATTTCATAGTTATCCTATCGAAGATTATGAGCATGAATGGCCTTCAAATCCTCCATCATTCAAGGAGGATGTGGCTAATTATGGCACAAGTGT TAGAGGGCTAGAATTCGCATTGCTTGAAGCCATATCGGAGAGCCTAGGCCTGGAAAGAGATTATATAGACAAGACATTGGGCATGCATGGCCAAGGGATA GCCTTGAACTACTATCCACCTTGTCCACAGCCAGAGCTTACTTTCGGATTGCCTGGCCATACTGACCCTAGCATAATCACTATTCTTTTGATTGATGATG TTCCTGGACTCCAAGTCCTCAAAAATGGCAAGTGGGTTAATATTCGTCCTATTCCCAACACTTTCGTCGTCAATGTTGGTGATCAAATTCAGGTACTTAG CAATGATCGATACAAAAGTGTGCTTCATCGTGTTGTTGTGAACTGCGATAAAGAGAGAATATCTATTCCTTCGTTTTACTATTCATCACCAGATACAGTA ATAGGGCCAGCAAAAGACTTGATCGACAATGACCATCCAGCCATCTATAGAAAGTCTGCATGTAGAGCATTCAATGAGAGAATGTGGAATGGAGGGCTTG CAGCAGCTAAAGCAGCGAAATCCCAACCAGATGTGTCCAGTCCTGCTGCTTAA
AA sequence Show only first row Show all	>Potri.001G451600.1 pacid=42792585 polypeptide=Potri.001G451600.1.p locus=Potri.001G451600 ID=Potri.001G451600.1.v4.1 annot-version=v4.1 MMYSNEVLSSLLISDVKDVPSNNINPIFDLPKLSELDASDDSIPLIDLDGLNGPNRSLIINQIGQACEEYGFFMVKNHGIPEATINNIQSTAMKFFKLPN EERLKFQSIDPTKTIRLTTGFNNKNQKVFVWRESLKFHSYPIEDYEHEWPSNPPSFKEDVANYGTSVRGLEFALLEAISESLGLERDYIDKTLGMHGQGI ALNYYPPCPQPELTFGLPGHTDPSIITILLIDDVPGLQVLKNGKWVNIRPIPNTFVVNVGDQIQVLSNDRYKSVLHRVVVNCDKERISIPSFYYSSPDTV IGPAKDLIDNDHPAIYRKSACRAFNERMWNGGLAAAKAAKSQPDVSSPAA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G10500			2-oxoglutarate (2OG) and Fe(II...		Potri.001G451600 [exp]	0	1
AT4G30440		GAE1	UDP-D-glucuronate 4-epimerase ...		Potri.006G178500 [exp]	9.64	0.7929
AT4G00467			Calcium-dependent lipid-bindin...		Potri.014G084100 [exp]	24.28	0.7687
AT5G58330			lactate/malate dehydrogenase f...		Potri.010G230000 [exp]	31.96	0.7638
AT5G38200			Class I glutamine amidotransfe...		Potri.010G120600 [exp]	47.56	0.7189
AT5G46295			unknown protein		Potri.004G131200 [exp]	47.81	0.7702
AT4G24570		DIC2	dicarboxylate carrier 2 (.1)		Potri.017G047800 [exp]	53.47	0.7326
AT4G31980			unknown protein		Potri.001G017900 [exp]	66.24	0.7380
AT5G55090		MAPKKK15	mitogen-activated protein kina...		Potri.003G130000 [exp]	102.04	0.7339
AT3G45670			Protein kinase superfamily pro...		Potri.006G181000 [exp]	129.49	0.6698
					Potri.001G422750 [exp]	133.24	0.7236

Compare expression of checked genes

Potri.001G451600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.