Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G10500 451 / 6e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10490 445 / 1e-157 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G24530 353 / 1e-121 DMR6 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G36690 253 / 1e-81 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G44800 244 / 1e-78 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G60290 239 / 1e-76 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G05600 225 / 5e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G38240 220 / 3e-69 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G07480 218 / 2e-68 KUOX1 KAR-UP oxidoreductase 1 (.1) AT3G55970 213 / 3e-66 ATJRG21 jasmonate-regulated gene 21 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G150100 [exp] 523 / 0 AT4G10490 501 / 2e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451900 [exp] 513 / 0 AT4G10490 498 / 3e-178 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.014G106700 [exp] 470 / 2e-167 AT4G10490 468 / 2e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451600 [exp] 442 / 3e-156 AT4G10500 406 / 5e-142 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451300 [exp] 370 / 5e-128 AT4G10500 326 / 1e-110 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.012G006300 [exp] 368 / 2e-127 AT5G24530 506 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G151000 [exp] 362 / 7e-125 AT4G10500 287 / 2e-95 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451500 [exp] 358 / 4e-123 AT4G10500 325 / 2e-110 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.015G002800 [exp] 357 / 4e-123 AT5G24530 521 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030185 [exp] 431 / 9e-152 AT4G10490 442 / 3e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10032930 [exp] 364 / 1e-125 AT5G24530 504 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10015573 [exp] 355 / 2e-122 AT5G24530 510 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10035782 [exp] 255 / 7e-83 AT5G24530 258 / 4e-84 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10024882 [exp] 248 / 2e-80 AT5G24530 271 / 2e-89 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10000711 [exp] 241 / 2e-77 AT5G24530 263 / 4e-86 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10032502 [exp] 240 / 6e-77 AT5G07480 396 / 3e-138 KAR-UP oxidoreductase 1 (.1) Lus10014398 [exp] 238 / 8e-76 AT2G36690 482 / 4e-171 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10023890 [exp] 229 / 2e-72 AT2G36690 486 / 5e-173 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10005037 [exp] 219 / 2e-68 AT3G11180 471 / 3e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.001G451700.1 pacid=42793552 polypeptide=Potri.001G451700.1.p locus=Potri.001G451700 ID=Potri.001G451700.1.v4.1 annot-version=v4.1 ATGGCCACGAAGTTACTTCTAACTGACGTTGCTGCTTCATGTGTAAAACAAATTCCTTCCAATTACATCCGTCCTATCTCTGACCGTCCGAATTTTTCCG AGGTGGAAAGATCCGGTTCCATTCCTCTTGTCGACCTTGAGGGGTTGCACAGTCATCGCCGCTCCGAGATCATCATGCAGATTGGTCAAGCTTGCCAAGA CTATGGTTTCTTTTTGGTGAGGAACCATGGCGTTCCGGAGAAGATGATGAATAATGCACTACTCATGGCAAAGGAGTTCTTCAAGTTACCAGAGAATGAA AGGATGAAATATTACTCTGATGATCATAGGAGGAGCATCAGGTTGTCGACTACTTTTAACGTTAAAACTGAAAAAGTTTATATCTGGAGAGATTTCTTGA GATTTCATTCCAATCCTTTAGAAGATTATGTACACGAATGGCCTCCAAATCCTCCATCCTTCAGGAAGGACGTGGGTGAATATTGCACAGGTGTTAGAGC GCTGGTTTTGAGACTGCTAGAGGCTATCTCAGAGAGCCTAGGACTGGAAAAAGATTATATAAATAAGGCACTGGGCAAGCATGGCCAACATGTTTCTATG AACTACTATCCACCATGTCCACAACCAGAGCTTACTTTTGGAGTGCCAGGCCACACTGATCCTACCATGATCACTGTTCTTCTACCAAATGAAGTGCCTG GATTGCAAGTTTTTAAAAATGGCAAATGGATGGCAGTCAATTCTGTTCCCAACACCTTTGTGATCAATATCGGTGACCAAATGCAGGTACTTAGCAATGA TCGATATAAGAGTGTGCTACATCGAGCTGTAGTGAACTGTGACAAGGAACGAATATCCATCGCTACATTTTACTACCCATCACTTGATGCTACAATGGGA CCTGCTAAGGAGTTGATTGACGATGATAATCCAGCAGCCTACAGAAATCACTCATTTAGTGAATTTTACGAGAAATTCTGGAACAGAGGACTTGCCACTG AATGCTGCTTATTAGACCTCTTCAAATCTTCTGTTGTTTAG
AA sequence Show only first row Show all	>Potri.001G451700.1 pacid=42793552 polypeptide=Potri.001G451700.1.p locus=Potri.001G451700 ID=Potri.001G451700.1.v4.1 annot-version=v4.1 MATKLLLTDVAASCVKQIPSNYIRPISDRPNFSEVERSGSIPLVDLEGLHSHRRSEIIMQIGQACQDYGFFLVRNHGVPEKMMNNALLMAKEFFKLPENE RMKYYSDDHRRSIRLSTTFNVKTEKVYIWRDFLRFHSNPLEDYVHEWPPNPPSFRKDVGEYCTGVRALVLRLLEAISESLGLEKDYINKALGKHGQHVSM NYYPPCPQPELTFGVPGHTDPTMITVLLPNEVPGLQVFKNGKWMAVNSVPNTFVINIGDQMQVLSNDRYKSVLHRAVVNCDKERISIATFYYPSLDATMG PAKELIDDDNPAAYRNHSFSEFYEKFWNRGLATECCLLDLFKSSVV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G10500			2-oxoglutarate (2OG) and Fe(II...		Potri.001G451700 [exp]	0	1
AT5G37660		PDLP7	plasmodesmata-located protein ...		Potri.017G130800 [exp]	2.44	0.9363
					Potri.010G242050 [exp]	2.82	0.9033
AT1G29730			Leucine-rich repeat transmembr...		Potri.010G155000 [exp]	9.16	0.8966
AT4G38840			SAUR-like auxin-responsive pro...		Potri.004G165300 [exp]	10.00	0.9025
					Potri.007G039901 [exp]	20.49	0.8007
AT3G63530		BB2, BB	BIG BROTHER, RING/U-box superf...		Potri.001G267700 [exp]	21.35	0.8826
AT5G03120			unknown protein		Potri.006G130400 [exp]	23.55	0.9053
AT3G16070			unknown protein		Potri.001G182500 [exp]	23.66	0.8331
AT1G71140			MATE efflux family protein (.1...		Potri.004G093400 [exp]	23.91	0.8526
AT3G44735		PSK1, ATPSK3	PHYTOSULFOKINE 3 PRECURSOR (.1...		Potri.009G148900 [exp]	30.39	0.8235	Pt-PSK6.1

Compare expression of checked genes

Potri.001G451700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.